CAZyme Information: PGTG_20955-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_20955-t26_1-p1
• CAZy Family: GT58
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	DS178268|CGC1	35654.23	5.0399

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178268:803090-804657(+)

Full Sequence      

MNLTHEYNYARTHVKAIDWSYVVGSHINLDSIYEGPQISLFEAVIRYLGGLISAYDLSGD
DLMLQRAEDLADWLLPAFGTSSGFPVTHYQLGLNPNGKRAGRVVTADVGSLALEFTRLSQ
LTSKDFYYDNVQKIIDLFDGDQWVSPDRLGTLFPETVDAEDPESLSEKYSMGGMMDSYYE
YLIKQHQLLRGRRSQYSKMYTSAIESARTHLIRTYDIESPGGKNFTVIGSMEAGVFTPTL
DHLSCFAGAMIGLGARLLNRKGDLDLALKHTDSCVWAYESTQTGVGPEEAWLLGGNEYTR
WKIVNYKGFFFFVSPKAC

Enzyme Prediction     

No EC number prediction in PGTG_20955-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	1	292	2.2e-74	0.625560538116592

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.36e-88	1	302	47	340	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.43e-57	1	301	124	413	glycoside hydrolase family 47 protein; Provisional
226696	TerY	5.21e-04	50	145	84	181	Uncharacterized conserved protein YegL, contains vWA domain of TerY type [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR39313.1|GH47	8.44e-77	1	305	406	762
CDI56918.1|GH47	1.15e-65	1	305	495	799
CDU25238.1|GH47	1.77e-65	1	305	305	609
CDZ96298.1|GH47	9.66e-65	1	315	262	585
CBQ69029.1|GH47	2.16e-64	1	305	305	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KKB_A	4.73e-33	37	297	102	358	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	5.26e-33	37	297	100	356	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KIJ_A	3.53e-31	37	288	81	326	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	3.66e-31	37	288	81	326	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	3.79e-31	37	288	86	331	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18498|MA1A1_SPOFR	8.95e-36	18	288	265	526	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|O60476|MA1A2_HUMAN	8.46e-34	12	288	226	508	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
sp|P39098|MA1A2_MOUSE	1.03e-32	12	288	226	508	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|Q9NR34|MA1C1_HUMAN	8.63e-32	26	297	248	508	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1
sp|P45700|MA1A1_MOUSE	9.52e-32	37	297	277	533	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PGTG_20955-t26_1-p1.