CAZyme Information: PGTG_20771-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_20771-t26_1-p1
• CAZy Family: GT49
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		38881.73	4.8392

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178263:1853791-1855540(-)

Full Sequence      

MFYATGQWGASPSAYQTTANSWRVADDTLDNWNSFIRTLNAVFPYTLDTKGPYNDLGFLQ
LGENKLTMAEKITQFSFWAAAKSPLIFSTDISRLRQEEIALLTNPRAIAINQDDLGQSIT
LKHRYSGDMDIWSGPLSDGSTVAVIINWSDDDPQKTIQLADLGFSSAHMYEVLTGNDLGF
FKDSYSTTIEKHGSLFLKLTETKPAPQRNFKRFPVEMAEITGSAVMKDTSRGIKVAANLK
PDGKTGVRWKNIPGAKNGNTLVSFDYINAQLSAGNMDDSKLNFKHTAIIINDDFDHPFFV
DFPITGLTWENMAEGFLVSLPLHPGENTILVRGEGEWAPDFHCLSVEQTA

Enzyme Prediction     

EC	3.2.1.22:58	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	1	178	3.4e-38	0.7685589519650655

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	9.61e-27	1	113	152	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
178295	PLN02692	1.20e-23	1	147	204	352	alpha-galactosidase
166449	PLN02808	2.56e-23	1	169	180	350	alpha-galactosidase
177874	PLN02229	5.58e-20	1	181	210	403	alpha-galactosidase
407673	Melibiase_C	2.47e-14	126	199	1	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW24696.1|CBM35|GH27	4.48e-71	3	346	192	536
QRW11978.1|CBM35|GH27	1.33e-67	1	346	198	544
QRV83253.1|CBM35|GH27	1.33e-67	1	346	198	544
QRV97448.1|CBM35|GH27	1.86e-67	1	346	198	544
BAH10649.1|CBM35|GH27|3.2.1.22|3.2.1.88	2.86e-38	16	346	215	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F4C_B	2.04e-21	1	200	157	361	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
1SZN_A	1.80e-19	8	192	213	403	Chain A, alpha-galactosidase [Trichoderma reesei],1T0O_A Chain A, alpha-galactosidase [Trichoderma reesei]
1UAS_A	3.40e-18	1	157	157	313	Chain A, alpha-galactosidase [Oryza sativa]
3LRK_A	7.46e-16	1	166	181	380	Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRL_A Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae]
3LRM_A	7.46e-16	1	166	181	380	Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRM_B Chain B, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRM_C Chain C, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRM_D Chain D, Alpha-galactosidase 1 [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AX28|AGALD_EMENI	8.93e-35	20	202	216	402	Alpha-galactosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglD PE=1 SV=2
sp|Q0CVX4|AGALD_ASPTN	7.98e-32	7	205	196	403	Probable alpha-galactosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglD PE=3 SV=2
sp|A2R2S6|AGALD_ASPNC	1.50e-31	7	202	200	404	Probable alpha-galactosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=aglD PE=3 SV=2
sp|Q2UI87|AGALD_ASPOR	6.91e-31	1	207	194	409	Probable alpha-galactosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aglD PE=3 SV=2
sp|B8N7Z0|AGALD_ASPFN	7.96e-30	1	233	192	429	Probable alpha-galactosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aglD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999064	0.000987

TMHMM  Annotations     

There is no transmembrane helices in PGTG_20771-t26_1-p1.