CAZyme Information: PGTG_19823-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_19823-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		40407.92	5.4168

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178410:43946-45748(-)

Full Sequence      

MSRSNFVVRSNCEVDKLILKKSDTSSEVQVLGVEYSNCGTHCRVMVEREVIMSAGSIGTP
AILERSGIGNERILKPLNIPLALNLEGVGSNFSDHIFVFASYRLKPGHKTLEDLTRDPEY
AAEQKSIHEQSGGGLFSHPTSIFNFQALKSLVSEEEMHEGLKLLENCPSYLSPKQFEAVV
NRIKNGVALEFSLVNTFFEPDLPSDKDTSYLTANVILQYPLSRGSSHIKSQDPGEPPLID
PNYLMHPFDAWLLAQGGKQIRKIMAQDAFKDIILDEQYPGPSVQTQEQWEESIRKRASTS
YHPIGTCSMLPQSESGVVDPQLRVYGTQNLRVVDASILPVQLTSHPAMTVYAIAEKAAEM
ILNQ

Enzyme Prediction     

No EC number prediction in PGTG_19823-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	2	363	2.2e-105	0.6126760563380281

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.80e-63	1	363	213	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.23e-56	1	362	211	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.87e-46	220	357	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.63e-16	29	362	256	577	Protein HOTHEAD
366272	GMC_oxred_N	1.40e-08	5	95	141	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV86550.1|AA3_2	5.98e-70	2	359	119	483
QRV98565.1|AA3_2	5.55e-65	3	361	255	619
QRW15110.1|AA3_2	5.89e-65	2	359	127	510
QRW00600.1|AA3_2	3.13e-64	2	359	126	509
QRW17440.1|AA3_2	4.99e-64	3	361	243	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.82e-44	3	361	224	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.14e-38	2	361	218	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.71e-38	2	361	219	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6XUT_A	4.97e-34	24	361	255	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
6H3G_A	1.31e-31	3	364	218	623	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	2.39e-55	3	363	269	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.39e-55	3	363	269	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A5C1RDA6|ASC9_DIDFA	6.81e-53	1	362	235	617	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	5.60e-48	3	361	269	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.25e-47	1	361	229	608	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PGTG_19823-t26_1-p1.