CAZyme Information: PGTG_19743-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_19743-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1017		114766.57	6.7347

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178419:11539-16327(-)

Full Sequence      

MPLRSANVRKRFLAAASGQGPPLPPTHTSLSTFKWSLANANRSIVVPTPFLNQPHLALIE
AGLIDDPNIGLNEGTTRWVGEEEAWTWETQFKVDTDGAWAKVERFYLVFNGLDTFCDIHV
NGHRIGSTDNAFRSWVFDATQVIKSSLNQTIPLSLRFASAYSTASKLAHEPGNMWFPNKS
ADKKRTTTLQPFEYSYRNWARKQQSDFGWDWGPAYLPSGPVQPAYLIGLSAPAQSNLGLV
KQTKADPRRAKVKAPTAKKQKNSSLPVDKKLEKAANAPNPPSLWVHRTVIDIYRQGIKHT
TDLLLASPLLDQRNNLLPDQSAPWVINITLPITSPKSINATLSGVLSGTSIKLPATQLST
LKTPQYRDYGPDYSLTVEYVVDPEEIELWYPATLGNPKLYDLELTLKLEGQRASSSIDEG
LTWKEKVGFRTIVVDQSRYTQEEVSRGVQPGTRFTFIVNGKPFYVQGSSMIPIDNFAART
NSTTIRWLIESALLAHQNVIRIWGGGAYQTDEFYDICDELGILAWSESVFACGAYPLSPE
SFLDNIRAEVSENVARLNRHPSTALWAGNNEGEGYLIDVNKTWANGSIYFNQYDHLNNHV
LRDLVLDNTRSISYIPSSTTQGYFTLDPYVSRYYNSTPGELYGDKEHYNYNTSASFDITS
YPVARFVNEFGFHSMPSIYTWDRILESPEDYDFNSTVIRAHEKHNPAESLVYPWPADDGQ
MQLTTGVTRHYPTPNITGDYHTLLAQWSYSTQVFQAAFMASEIHYYRLGASRGENNMGKS
ALQVNDVWEGQSWSSIEYTGRWKIFHYLAERVQSHVIISPIFHQTNNTLDIYVTSDLWQA
VEGTAEWTWYDFAGRQLSKTTKKFSVGSLNSTHLYHSAGLSTIVPNGHPPNDAWMHLTMT
TSDGKYTNEQFFHPVALRDCKLRATKVQSRPIGHNQVSVEVASGGVAAWVNVEHPPGVRG
YFKDMTTKLPSNDFFLRPDEKRQLEFVLRDQDHDDAAQNLESKMVVRTLWDNQHPTK

Enzyme Prediction     

No EC number prediction in PGTG_19743-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	43	901	3.4e-61	0.6861702127659575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.23e-32	384	812	248	628	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	6.68e-15	827	919	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
407625	Ig_mannosidase	3.43e-10	934	1011	12	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
236673	ebgA	5.80e-05	376	571	273	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
236657	PRK10150	1.39e-04	388	575	244	421	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16350.1|GH2	1.99e-184	30	1013	27	929
BCS04781.1|GH2	1.99e-184	30	1013	27	929
BCS20939.1|GH2	9.00e-184	27	1013	21	922
CAK96951.1|GH2|3.2.1.25	2.99e-183	30	1013	27	928
A2QWU9|GH2	2.99e-183	30	1013	27	928

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CVU_A	1.66e-170	30	1015	33	942	Structure of Fungal beta-mannosidase from Glycoside Hydrolase Family 2 of Trichoderma harzianum [Trichoderma harzianum],4UOJ_A Chain A, BETA-MANNOSIDASE GH2 [Trichoderma harzianum],4UOJ_B Chain B, BETA-MANNOSIDASE GH2 [Trichoderma harzianum]
6DDT_A	2.09e-85	35	837	18	699	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
2VQU_A	1.81e-62	35	869	15	703	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]
5N6U_A	2.17e-62	55	953	53	787	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	2.45e-62	35	869	15	703	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CI48|MANBA_ASPTN	9.88e-185	16	1016	13	932	Beta-mannosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndA PE=3 SV=2
sp|A2QWU9|MANBA_ASPNC	5.30e-184	30	1013	27	928	Beta-mannosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndA PE=3 SV=1
sp|Q5BCI8|MANBA_EMENI	2.70e-183	27	1016	23	928	Beta-mannosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndA PE=3 SV=1
sp|B0Y7S2|MANBA_ASPFC	9.95e-171	22	1013	14	923	Beta-mannosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndA PE=3 SV=1
sp|Q4WMS9|MANBA_ASPFU	3.88e-170	22	1013	14	923	Beta-mannosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PGTG_19743-t26_1-p1.