CAZyme Information: PGTG_18437-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_18437-t26_1-p1
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598		64965.44	5.3407

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178355:192143-195233(-)

Full Sequence      

MDWASPPALPEHAVSFAVSWWIGCHEKPFAALDMLAPYKKHCTYTSGFITFLARYTSDCS
MGDFPKSKCFHGGVGITHTRTGTSPLSPRGFGTVLQNLLGSSFISGKEGTQAMMTLVQNA
YKNTMLGAGKEMPSFLQSFSSTVELFSITIESSPPNGHVSVSFSSSSSSAEAHSNSAKVQ
FSTDLPITNTTMIPDVGSGNSTHNANSNPKKTGGRKLAGYYPVYNAEGQPLSELRYDLYD
EIIFFVATTTENFTLGTYPLNQNEWDSLAFDFVKSCKNHSVTPTYAVGGWGGSRYFSALT
ATSENRTAFADSTISFAKKYGFEGIDFDWEYASIQGIGCNTVNDADVQNQQLLFKEVKSK
WPEGKLSTAQSIAGIRDANYGKLPASDVSLMAQVVDEVRIMAYDVHGSFTKTTGPNAPIR
ATCADPENQLSVETAIEIYLKQGFKPEQLSLGIPGYAKSWTLAKPELTPRIVGNYTSYYY
QNYTGIPAGGRYDDQPGLDVCGQKTGYGGSWLVNELVTAGFLNEDENSGGKGYTRYYDEC
SGEPFLASETTLITYDDTASTVAKVEYANSKNLGGVFFFDTMGPRDKTVKAARTALSN

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	216	582	1.2e-50	0.9256756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	1.66e-56	216	580	1	303	Glycosyl hydrolases family 18.
214753	Glyco_18	2.08e-56	216	580	1	330	Glyco_18 domain.
119365	GH18_chitinase	1.33e-54	286	578	90	316	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	1.63e-51	277	578	67	335	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	1.46e-49	270	592	118	431	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP42832.1|GH18	3.65e-122	216	598	36	420
ALL41259.1|GH18	5.02e-87	401	596	1	198
CDR43393.1|GH18	3.86e-70	217	596	26	405
CRX79101.1|GH18	3.12e-60	244	577	7	336
QRV99381.1|GH18	1.78e-56	218	586	46	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	6.57e-34	278	590	120	412	Chain A, Glycosyl Hydrolase [Niallia circulans]
6BT9_A	1.93e-33	257	583	125	447	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
5XWF_A	8.62e-32	214	576	1	347	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6JM7_A	1.12e-29	245	579	40	345	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6KST_A	9.19e-29	213	589	5	362	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	4.86e-32	278	590	152	444	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q9D7Q1|CHIT1_MOUSE	7.43e-27	243	575	54	352	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
sp|Q13231|CHIT1_HUMAN	1.02e-26	255	575	61	354	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	1.09e-26	264	575	70	356	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q9W092|CHIT2_DROME	1.03e-24	286	576	123	381	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PGTG_18437-t26_1-p1.