CAZyme Information: PGTG_18387-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_18387-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		41354.58	6.0979

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178363:223187-224605(-)

Full Sequence      

MLVITALFAALHLISGTGALVARAESKPTLAVYYPGYHSNLLPPESIPWDLYTHLDYFVA
TTGSEPSDDLKIENEENLKAVVSGAKSHGVSVSLTVGGWTGSKYFSKLVADEESRKTFVQ
TILRAVKKYDFDGVDLDWEYPNVPGNDGNILSKDDSANYLKFLKTLRQVLGSKARISAAV
AVHGFMGPDGELAGPNAPMFDTCNDPEVKFSVDQAIKTWTSTGFPAAQILLGLPAYGYKY
TMPNSELAPTNFSGQSNLTSLFFSKFDKSAAPAPTESSTAGPTTCGGEEDGHTWLYKDLV
ACGMLSADGSQGLKGFTRHYDHCSRTPFLFDPSSKTFISYDDPRSLARKTKFAKSSGLAG
VNVFDATGDTQERVLIKAIKSSL

Enzyme Prediction     

EC	3.2.1.14:2	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	30	375	8.8e-54	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	3.57e-65	29	369	1	334	Glyco_18 domain.
119365	GH18_chitinase	1.55e-59	31	369	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	4.99e-56	29	369	1	307	Glycosyl hydrolases family 18.
225862	ChiA	2.45e-46	11	383	16	436	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	5.14e-44	31	383	9	362	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR43393.1|GH18	2.21e-76	16	383	8	405
QRV87962.1|GH18	2.20e-71	25	383	119	504
CAC35202.1|GH18	3.97e-71	31	383	52	429
QRW02133.1|GH18	4.92e-71	25	383	153	538
QRV73087.1|GH18	1.70e-70	25	383	119	504

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	2.01e-48	44	380	14	366	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6BT9_A	9.47e-31	85	369	153	448	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
1ITX_A	9.87e-28	73	383	118	419	Chain A, Glycosyl Hydrolase [Niallia circulans]
6KXN_A	1.88e-27	30	383	9	370	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KST_A	2.59e-27	44	383	25	370	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	2.36e-26	73	383	150	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|P36362|CHIT_MANSE	1.10e-24	31	360	33	366	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q13231|CHIT1_HUMAN	8.81e-23	44	364	43	358	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q9W5U2|CHI10_DROME	3.70e-21	44	360	986	1301	Probable chitinase 10 OS=Drosophila melanogaster OX=7227 GN=Cht10 PE=2 SV=2
sp|P48827|CHI42_TRIHA	6.26e-21	87	369	119	383	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000296	0.999676	CS pos: 24-25. Pr: 0.5986

TMHMM  Annotations     

There is no transmembrane helices in PGTG_18387-t26_1-p1.