CAZyme Information: PGTG_18266-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_18266-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634		71665.84	6.0631

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178364:147216-150210(-)

Full Sequence      

MESSGSASHQLEPRTLMMTSKSRKARESTSLPNLQDHHHRRRRRRGPSIGWTLSLALMAA
LSLASCFGLSNASMSTQRKLELRDLVKKTWYHGFDNYIKHAYPDDELRPLSCKGIGHDHE
HPNSHETNDVLGDFSMTLIDVLDTFVALRDVGRFRDSVRRIVTDIPSFDIDSKVQVFETT
IRVLGGLLSGHLFAKDPENVWGFRLDNNGDEQEGSSYADQLLFLAKDLADRLMPAFHASS
LAFLMLALILLRYGLMPDEGTETCTAGAGSLLLEFATLSRLLGDPIYENVAKKAFYALWD
RRSSINLLGNTIDIQTGHWSYGVSSIGAGIDSFYEYILKSHVLLSDDSFLEIWNQAYKAV
MTYMRSPDGFWYRGVNMQTGAVATTTIDSLSAFWPGLQVLAGDIEAAIQSHMTYANLWAR
YSGIPEVFDIHRKQATSLGYPLRPEFVESNYFLYRATKDEYYLEVAERVITDLVNRTWVD
CGLASIENLLTGKLEDRQHSFMLSETLKYLYLTFDEDNPINHADQPFVFTTEGHILYIPN
ADQMAENQGYRTGWEERESLESDRVVWESHPTGRRQQSKPPTCSVYSPSLQSPKHSNPLM
LSITGRTDFDYAKMITGSLDSGPRLASVRSQSRM

Enzyme Prediction     

EC	3.2.1.113:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	91	537	7.2e-127	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.22e-130	91	536	3	451	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	6.97e-66	71	542	65	522	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR48802.1|GH47	4.02e-174	52	617	11	563
QRW05174.1|GH47	1.25e-171	71	617	41	558
CDR48801.1|GH47	1.05e-170	52	617	11	563
QRV76268.1|GH47	5.02e-168	71	617	41	558
CDS05465.1|GH47	3.04e-166	90	550	2	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AYO_A	2.02e-41	86	536	17	433	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
5KKB_A	1.62e-36	68	538	8	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.85e-36	68	538	6	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
1DL2_A	2.60e-32	81	554	4	509	Crystal Structure Of Class I Alpha-1,2-mannosidase From Saccharomyces Cerevisiae At 1.54 Angstrom Resolution [Saccharomyces cerevisiae]
1KKT_A	4.74e-32	49	538	5	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	2.70e-145	73	567	26	506	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q92611|EDEM1_HUMAN	8.12e-135	71	538	119	586	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	1.97e-134	71	538	114	581	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q9FG93|MNS4_ARATH	5.22e-116	68	554	26	490	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
sp|Q6GQB9|EDEM3_XENLA	2.32e-114	61	536	16	482	ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis OX=8355 GN=edem3 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.986119	0.013865

TMHMM  Annotations     

Start	End
49	71