CAZyme Information: PGTG_17725-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_17725-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		39583.38	8.6587

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178347:140037-142053(+)

Full Sequence      

MKISLDMLVSALLLPLASQSITVPSHRRVFHGNLGLNSTNLHRAGVAVGFLPGFRERIAP
NAVRDINNLLPAPMAIVGDYIHLEEHDPNLSTLDLHLPHILSSPGNPVWQIALLPSEGLE
KVTPYVADRIAIKMASINKLGITVWLRFAHEMNGDWYGWGLKPELFRQKWRMLAHAIRAR
THGTYMLWAPNVAFGSYEDSIRGGYSRYWPGADTVDISGLSFYHFGGEDRLNVLPRPGEA
LEKIQEFSQLYGAGQGKPIVLAETGAAYTTSLRTGRPTFGGASNHDIKFAWLKQLLSGEL
KQRVPELKAISWFELIKDENAGVQGTNVKCEDYRLIVGEERLSRDAVRFLQGGYY

Enzyme Prediction     

No EC number prediction in PGTG_17725-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	128	270	7.1e-23	0.40264026402640263

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226609	ManB2	4.72e-12	141	266	179	297	Beta-mannanase [Carbohydrate transport and metabolism].
396639	Glyco_hydro_26	1.12e-09	114	223	124	230	Glycosyl hydrolase family 26.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41269.1|GH26	6.27e-119	34	352	49	368
ALL40962.1|GH26	3.97e-105	74	354	1	281
ALL40740.1|GH26	5.08e-81	122	349	2	230
AGT80112.1|GH26	1.18e-70	35	312	61	358
AFR27662.1|GH26	5.58e-37	111	319	129	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WHK_A	3.51e-07	128	237	144	261	Structure of Bacillus subtilis mannanase man26 [Bacillus subtilis]
2QHA_A	3.59e-07	128	237	144	261	From Structure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis],2QHA_B From Structure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis]
3CBW_A	3.71e-07	128	237	153	270	Chain A, YdhT protein [Bacillus subtilis],3CBW_B Chain B, YdhT protein [Bacillus subtilis]
7EET_A	2.05e-06	128	223	164	262	Chain A, Mannanase KMAN [Klebsiella oxytoca]
2BVD_A	5.08e-06	127	338	84	281	Chain A, ENDOGLUCANASE H [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O05512|MANB_BACSU	1.96e-06	128	237	170	287	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000547	0.999409	CS pos: 19-20. Pr: 0.9679

TMHMM  Annotations     

There is no transmembrane helices in PGTG_17725-t26_1-p1.