CAZyme Information: PGTG_17357-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_17357-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597		66526.74	6.9157

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178346:126961-129006(-)

Full Sequence      

MSFGQTPQVDGDLFAPVESQRKHPVPPLSLFGPGCAHPQSPLHISDGSRHRPIGTNKWYT
QLMLTPSGTDPIYPLPYALAFLDGSSVLSCRGRERTESLVGLGILHSSAAQRVFGPPVGP
DPDSSARYYYNPLAVSVCLGAKEFSGQSKVAPLTSDWSELTVQFELSSTTKGPPKSSISF
PISRGSAFVTALYTGLSPRLGSTHVILSLECVNPGEEHHLYGFRKHRLRYNDGSTWLVYS
LGDQTVSCSSHLDLQKITSTDVGHPGTWSGIIQLVKMSDYYGRELEENSHRLGEEFVYDN
GIGVWTQAATLRSGPMGTGQYSFDWITNGPRSNSAQPLMFALPHHIEALSDPIIVVKPEI
RIQSRVTGVMRLCRGDRWLFKENVADLRNFGITPYRSPNGAPLYDPLKVDLLRQVMVKEL
DTDFDSESNLDSYYFSGKKLAKQALQCLTASCVLQDQNLATKFVEKTKKSFDKFRHNRSK
AAPLVYENTWKGIISSSILRTGNRNDDFGNGVYNDHHFHYAYFIHAAAVLVYHDHSYLYS
VRDYIHDLIRDVNSSDESDSFFPLFRNFDWFLGHSLATGLDTSIDGKNQESCSEDAK

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	38	596	3.6e-106	0.7347266881028939

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	1.99e-106	24	595	63	591	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	3.17e-76	410	596	8	192	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.44e-70	37	383	1	308	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABH10633.1|GH81	1.21e-83	37	595	25	546
NP_594547.1|GH81|3.2.1.39	1.03e-79	27	595	11	538
CAA91245.1|GH81|3.2.1.39	1.03e-79	27	595	11	538
AAF13033.2|GH81|3.2.1.39	3.06e-79	52	596	44	556
CBF89420.1|GH81|3.2.1.39	9.27e-79	4	596	183	734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	9.19e-58	10	594	4	557	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.22e-57	10	594	29	582	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	7.74e-56	10	594	4	557	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	5.27e-14	364	594	282	496	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.00e-09	228	594	159	520	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.83e-80	27	595	11	538	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	2.58e-72	12	595	192	734	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.33e-66	27	595	57	574	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	4.09e-58	27	595	87	614	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	3.23e-56	11	594	426	973	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000006

TMHMM  Annotations     

There is no transmembrane helices in PGTG_17357-t26_1-p1.