CAZyme Information: PGTG_17055-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_17055-t26_1-p1
• CAZy Family: GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		59635.54	6.8031

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178338:120301-122834(+)

Full Sequence      

MFCKIILLGLALIAHPAIGGLPKTCKYGTNLGGWLVSEPWMKPVEWAAMGGEYCPKDSSS
CAASEWGLARKLGQQLANESFLKHWQSWFNQDHVDRLKALNLDHVRIPLGFWIVEELVEA
PAELYAQGGWMELKRGLRQLRDAGFHVTLDMHALPGVSTSNQMFAGNVTSDVQFYKDHNY
QRALTWSAVLTSMSHLDPDFSSVVAIQCINEPLTDANLTPGLEQYYSDFVTVTRVIEYAI
GVECEVDLRESIYRLSQSKNSMAALHAAMPLIVTYASKANIVIDPKVLDALKSFLLRPSP
VATAPSPVETTIIPATRRSITSAPAVSTKGSLACQSSQRNAVNNAHLKCSRSLTPRSCLA
TMAMPKRWQWKGEANSMANHTLGPAAYDDHLYYAYGGVAEPNIKSYVSTMCTQQDLQTAK
KNGEEPYGHGEFSLAVNFNATHDDLRAWGDAQRFKYNQDHYWTFWTFRLGQVLEPNLTQS
YTETWSYFGAVDAGVWPRDPSQYFNPSICTPFLNSTDNSSKVQLPDTHLNQAKRD

Enzyme Prediction     

No EC number prediction in PGTG_17055-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	73	246	6.3e-41	0.58

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.63e-09	27	226	19	208	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW22487.1|GH5_15	2.80e-121	7	516	12	568
QRW22469.1|GH5_15	2.43e-120	8	516	8	547
QRV95252.1|GH5_15	4.02e-116	9	516	9	548
QRW09473.1|GH5_15	1.40e-114	7	513	12	538
QRW22468.1|GH5_15	2.04e-112	1	516	1	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.73e-17	28	228	11	203	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	5.57e-17	28	228	11	203	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3N9K_A	5.78e-17	28	228	16	208	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
4M80_A	5.78e-17	28	228	16	208	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
2PB1_A	5.83e-17	28	228	17	209	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	2.21e-38	21	509	45	409	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|Q0C8Z0|EXGB_ASPTN	8.70e-36	28	509	47	403	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	5.00e-34	28	509	44	399	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|B8NBJ4|EXGB_ASPFN	2.11e-33	28	243	45	253	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	2.69e-33	28	243	45	253	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999768	CS pos: 19-20. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in PGTG_17055-t26_1-p1.