CAZyme Information: PGTG_16708-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_16708-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1620		180495.44	5.2245

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178336:63803-70461(-)

Full Sequence      

MKRSRGLRDRLGLLLTLGVDILAGSPPISVSIQATWQEPPMLIQVLESAALERPGLFFSS
IDAVCSGWESSKRSTDQQTYEYLTSLLRSPGLLDGPGELESLAFSIALKEAQPKIEAFRV
WYASLPSNLTGQSETQASESDDCKSWTLINNSRICDTSKLSELLDSNDPSEKIQSQPQVL
PFDHQQGQSHENARLPIAILYASPDPSSFCPFHQVLHKASKELPSKATYIFRWKIPSAPS
SSTKSQSASLLSGWGASLDIKKSEYLTLDDRPVESSSSDDPQLILDGTKQPAGRESQVDS
EPAKLKPLKAAEIFDIGAKATQHVLSSPSPLTALRHLTEDFPLIAHTLVNEWVPGRISRE
LRLELKENMEDGIPPGRSVVWMNGLQLSSLVSLENLNLFKLVEIMRNERRWITSLTSLGI
NSLQARKLIVDEKLNSAMNPEAASASASGEMDASSLGARFDASDRQEGGGAIIWFNDLEK
DERYSMWPTTLRAILRPTFPGQLHPIGRNLINVVLGLDLTQTQNLHNLGHVIEVFIARSL
PIRWGVVPIPTKNPSQAEKMSRSFWNMIEALGPIETLKFIKEFTQDLEPESGAIDVEKFI
SKANQSVLSAEEESPEDPQSKEERFQVWLTKSQLYSSRLSLCSNDHSLPACMMINGRFFP
MEENYRTHLQETATLHTGFIQHQVYFNLLKDDANVAEYLYDLPLVHRARNDLVFPSEARP
LQFVDLVEALQSSDALAANVFFRNEAAPVKNGDPRPIASLWVVGNLDSNTGMSAVAAALG
LLMKPFPNVSTQVSFVHVPSDDTEISTEISTDLSALITTSDVQKITIQDLLDKLSGHGHQ
AMTSDDGDSTKTEKNSELVLKKIQTKASDLPNIKNRAWFGAQEFGKAIGAKRDGIAIVIN
GRLLQVSSTSKLLSEDLVLLVEYETQQRINPLMEALKSLEEFDVKQHHANLPLIMSTVGF
VLVGSNDGSTQTSSSEARSDKHLARNGVHSSYQHGDEAKALFDFSVVLNPTSEAAQRWSA
LLDTLSHRSDVAMKVWFNPSLEVSELPIKRFFRTAISNSLEFDKNGRVIPALVNFHGIPT
ETLFTLAIDSPPAWLALPHDSIHDLDNIMLSELPPAYSSQGVEAIFQLEHIILAGHAREV
PSDIPPRGLQIVLSDLLRNQEVDTIIMANLGYFQFKSAPGIHRLSIRPGRSLELYQFEKT
DSSADGNDESHQLLSLTTFNGLTIYPRVRKRPDKIGENLIQPLSTSPTTSKKGPAAEFSK
LMGQNQGIDLANGASRSVINVFTVASGLLYERMAYLMCVSVMRHTQSPVKFWFISNFLSP
SFKRFIPHLAREYGFDYQLVTYRWPSWLRAQKEKQRVIWGYKILFLDVLFPLEVDRVIFV
DSDQIVRTDLKALVDLDLGGAPYAYAPMCNDRNETKGFRFWDTGYWKESLQGRPYHISAL
YVVDLRVFRTVAAGDQLRQHYQALSADPGSLANLDQDLPNNMQGILPIFTLDQSWLWCET
WCSDEGLKTAKTIDLCNNPLTHEPKLKRARRLIPEWDAYDQEVAALAARIKKNNQGDLAA
KITVQAGQKIEDDQDLSSDPLSESDHLEKEQEDVMLDSSGLNQENPSTLLDKEGVSRDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1279	1526	1.3e-123	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1279	1546	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	3.85e-164	1279	1526	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	2.04e-71	460	713	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	2.20e-56	1279	1519	1	241	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	6.56e-49	38	239	1	182	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR47046.1|GT24	3.38e-318	25	1556	23	1640
QRV90671.1|GT24	6.79e-296	11	1547	4	1531
QRV75871.1|GT24	1.46e-294	25	1547	23	1531
KGB74213.2|GT24	2.73e-294	9	1564	4	1551
AUB22656.1|GT24	3.84e-294	15	1564	8	1551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	1.55e-275	22	1552	5	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	6.04e-275	22	1552	5	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	1.68e-274	22	1552	5	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	1.55e-235	25	1488	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	3.00e-203	897	1552	550	1219	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.48e-230	19	1546	13	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	2.62e-203	6	1555	20	1532	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	4.73e-202	2	1546	16	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	2.48e-201	2	1546	16	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	9.44e-194	25	1551	27	1512	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.614641	0.385344

TMHMM  Annotations     

There is no transmembrane helices in PGTG_16708-t26_1-p1.