CAZyme Information: PGTG_15162-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_15162-t26_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589		66917.42	8.1528

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178318:226956-229960(+)

Full Sequence      

MKIFPILFGLIWVKRIKCDINLPDHNSSIERRLSESSDRSRSGFVYAPGDGNLYLNGKLF
NFRNFNAPTIFEGGEYQGRDIFKSIAAFGAPVTRTYTLQIANDALEHGKLPPSAGHITGW
DKRTNDWIYNEDQWRKMDQMLDLSRHYGVKLIIPIINQDYGNPDSNYIGDFNDLIRHRYG
IYGYQEAGKKIDFFKDRSMIDSFKKLITFFLNRVNTYNGLRYGDDNTILAFETGNEMSWG
QFANLSSQPAPAPWTIEVSRHLKTLAPKILVMDGSYSRHPSFAWEKEALESKYVDLFSYH
FYGGGDTEAFDMLNGKVRAYGKTLVIGEHGFYSDVKVWRQVYKRMTCAGALAWSLLPHSE
KSGFLTHGEGHNIHGYHVPGWQKQTSKEFDTQEEEVITSTYEASYTILGLEPPPKPIPGR
PEAFIVTNGTHAGLSWRGEAWAAGYEIFGAEAWGRNFNLISDVIPDNVEAGGIFIPLDPE
RPTDSLNMTPRKSKADESHKGWTDRKWCRKRSLLGCHGSHQLIDWRGRDILGNLVGHSMK
VLASMEPIRDRDRPGGWYSVRGVSADGVPGKRSRPVFLETDWQNNKKGQ

Enzyme Prediction     

EC	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	79	363	8.6e-46	0.9921875

CDD Domains     

PGTG_15162-t26_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41339.1|GH5	4.05e-99	114	425	4	341
CDR43041.1|GH5	2.02e-97	36	477	40	479
ALL40758.1|GH5	1.94e-70	270	578	1	321
ABR27262.1|GH5_41	7.52e-45	58	447	36	391
AYQ73430.1|CBM23|CBM61|GH5	1.25e-40	44	471	60	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QP0_A	1.44e-18	42	364	2	336	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]
3PZ9_A	3.60e-12	131	362	96	349	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	7.03e-12	131	362	82	335	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5W6G0|MAN5_ORYSJ	4.90e-11	39	275	79	285	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2
sp|Q6YM50|MAN5_SOLLC	2.01e-09	31	300	26	275	Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum OX=4081 GN=MAN5 PE=2 SV=1
sp|Q9FZ03|MAN2_SOLLC	2.01e-09	31	300	26	275	Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum OX=4081 GN=MAN2 PE=2 SV=2
sp|Q9SG95|MAN4_ARATH	3.32e-08	39	274	16	237	Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana OX=3702 GN=MAN4 PE=3 SV=1
sp|Q9LW44|MANP_ARATH	1.36e-07	39	274	16	237	Putative mannan endo-1,4-beta-mannosidase P OS=Arabidopsis thaliana OX=3702 GN=MANP PE=5 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.680384	0.319613

TMHMM  Annotations     

There is no transmembrane helices in PGTG_15162-t26_1-p1.