CAZyme Information: PGTG_15160-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_15160-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601		67333.24	5.7646

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178318:213493-216358(-)

Full Sequence      

MGIFILMESCSTLEALTLPLYSTVRNIPGVQFMKNALNSFLNLFTGEEFQARDLMETISA
FGSPVSRTYTLHVANGMFPDGKQKSSSSHILGWDNSASDWVYNETNWRNIDKALDLARQH
GVKLIIPIINQDYGSSDTNWVGNFADLIRHRYNIQNYTIAQQAVDWFTDREMIKCYKQMI
SFYLNRINTFNGIRIGDDPTILAFETGNEMNWGYQNGSNAHDRPARANWTIEIAQFIKSL
APKTLVMDGSYSRNPKLAWEEEALASPFVDLFSYHFLRPSTSPILTGRLQFCATGYADGE
GETLPYHDWQSSLQNQVRAHGKTFIVGEHGFYDKPAVWEAFYKNVTCAGTLVWSLRSHSE
NGGFVTHGEGHNISSYHAPGFRNQTSEKFDTQEADVISSTYDASYRILGLEPPPKPIPGT
PEAFLVSNGTHAGISWRGAAWAQQYEVLGAIFQDAQFSTISRFVPDNVEDGQLFVPLDPT
DPTKPIHIALPEPIPHQSHAGWIDTKWCPPGSSAPCGDIHFDKQEDAKPPTTYRRLMPMS
PPTEQNSTKSHELNPTSQNRLISGGWFSVRAVSADGVPGGISESVFLKTQWEPHVGEREW
S

Enzyme Prediction     

EC	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	53	278	5.3e-39	0.73828125

CDD Domains     

PGTG_15160-t26_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41339.1|GH5	6.28e-98	88	428	5	344
CDR43041.1|GH5	4.88e-86	49	477	83	479
ALL40758.1|GH5	4.99e-57	245	585	1	319
AYQ73430.1|CBM23|CBM61|GH5	2.58e-41	49	447	91	446
ABR27262.1|GH5_41	3.69e-41	47	466	60	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QP0_A	1.27e-15	27	275	14	256	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]
3PZ9_A	1.52e-10	104	249	96	223	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	2.69e-10	104	249	82	209	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FJZ3|MAN7_ARATH	4.22e-11	26	254	40	246	Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana OX=3702 GN=MAN7 PE=2 SV=1
sp|O48540|MAN1_SOLLC	4.85e-11	29	358	39	359	Mannan endo-1,4-beta-mannosidase 1 OS=Solanum lycopersicum OX=4081 GN=MAN1 PE=1 SV=2
sp|Q6YM50|MAN5_SOLLC	5.06e-10	29	355	51	372	Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum OX=4081 GN=MAN5 PE=2 SV=1
sp|Q9FZ03|MAN2_SOLLC	5.06e-10	29	355	51	372	Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum OX=4081 GN=MAN2 PE=2 SV=2
sp|Q9LW44|MANP_ARATH	8.71e-10	29	249	34	237	Putative mannan endo-1,4-beta-mannosidase P OS=Arabidopsis thaliana OX=3702 GN=MANP PE=5 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000066

TMHMM  Annotations     

There is no transmembrane helices in PGTG_15160-t26_1-p1.