CAZyme Information: PGTG_14990-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_14990-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483		55203.31	6.1945

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178319:493010-495188(+)

Full Sequence      

MGTRQSRGKGSVAEGSQAINADEVIIRVIPDPRDSHPPGPQHHPEPAIPNERPRYVFAHV
VQGNFQFYQAEDWSSDMRLAQRMGIDAFAINIGRDVTNEKQLPLIYEIAEMNSFQVFLSF
DMVYYGQAGSSNDVIRLIETFAPRKAQFLYQGKPLVSTFSGEVPGNYLDNNPDYNSAWGS
LKAKLHFPKFWRRCHLVKIEVLTSPRPCWTGIDPKTVSSIDGMLSWDAWSPVSSSQDRRY
KDNLAALGKQYAAPLSAMFYKHLSAQRYGNYLYPTESWFVVEKFIALISLNPDFIEILSW
NDYGESHYLRDPRPSANLPMDTTSSEKYVNHMPHEPLLDLMSYFNEWYKSGSRPLIKRSR
AYVWYRTHPRDAVSKSDLLPAPNGASVTEDKMYIVILVSPATKLQYISIESGDKYYYTDL
EEHETFKRKDAILLISVPFHVGDNQTVTLYDPDETALGCLVGRGITAEPEIYNFNYWSGF
IEF

Enzyme Prediction     

EC	3.2.1.59:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	56	449	3.4e-81	0.968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	4.82e-107	56	455	1	369	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	1.16e-91	52	351	3	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	2.31e-20	56	343	1	281	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR43109.1|GH71	7.32e-72	53	478	29	463
AAT84064.1|GH71|3.2.1.59	1.34e-53	54	483	22	424
CAC48025.1|GH71	4.29e-53	47	479	30	427
ABF50884.1|GH71|3.2.1.59	4.29e-53	47	479	30	427
EAA61720.1|GH71|3.2.1.59	4.29e-53	47	479	30	427

PDB Hits     

PGTG_14990-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	2.38e-54	54	483	22	424	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|B6GX22|MU71A_PENRW	8.08e-51	54	479	36	428	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O94510|AGN2_SCHPO	4.94e-36	47	395	7	348	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PGTG_14990-t26_1-p1.