CAZyme Information: PGTG_14417-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_14417-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		68442.22	6.3923

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178313:182609-185931(+)

Full Sequence      

MALHSLLSTLLLSLSLSKLISTQAIRTGKTPNTFEVVGHSGASAQMMFIGTPTKTYVVDK
VENNELKLNGLPVWGTSYDTESNTATPMPINSNTFCAGGNVLGNGTWLNVGGNLAVSYGG
LNVANNFDPYKNKDGGKSMRLLNPCNDNSCQWAESTPMTTRRWYPTLETLEDGSIIIIGG
DDWGGYVNDKGQNNPTYEFFPSKGNVTGLNLLAISLPANLYPLTWLLPSGNLFINSNWNN
AILDYKTNTEFQIPNVPHAVRTYPGSAANAMLPLTPANNYTASLLFCGGTNLQPDQWKLD
WNIAAYPADATCVRITPDVDTNWRDDDSMPEGRSMGNFIFLPDGRLFLLNGIAKGTAGYG
NTSWALGQSFGDGPIYEPAYFDPNAPQGSRWSRPSDLKPSTVARMYHSVALLLPDGSIQS
SGSNPNADYVAPGTPGYPYFTEYKVERFYPDYYNKPRPKPTGLPTTISYGGNFFDLKLPK
EDISANDALEQTKVVIIRPGFSTHAINMGQRYVQLSSTYETNSDGSATLHVSQLPPNPAV
LAPGPAFIYVVVKGVPSIGAMVMVGNGQLGAQPTAAQPTLPGKTPAIVQKTETAAEMGSV
AGGKIAAKKGASTRSASISITNLLALVGLATLFNWLH

Enzyme Prediction     

No EC number prediction in PGTG_14417-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	28	582	3.7e-232	0.9857904085257548

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	1.50e-42	78	289	51	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
401164	DUF1929	1.50e-26	464	564	3	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	1.36e-25	452	564	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR36607.1|AA5_1	8.07e-264	32	581	30	582
QRW00801.1|AA5_1	8.94e-263	23	627	35	633
QRW15307.1|AA5_1	5.71e-261	23	593	35	605
QRV86752.1|AA5_1	5.71e-261	23	593	35	605
ALL40944.1|AA5_1	1.56e-260	30	583	26	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	2.28e-14	157	515	252	570	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	1.10e-12	157	515	241	559	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	1.11e-12	157	515	246	564	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
2EID_A	4.64e-12	135	564	243	637	Chain A, Galactose oxidase [Fusarium graminearum]
2EIB_A	4.64e-12	135	564	243	637	Chain A, Galactose oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01772|GLOX_PHACH	1.44e-66	40	567	35	552	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|Q9FYG4|GLOX1_ARATH	3.96e-58	65	564	146	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|Q3HRQ2|GLOX_VITPS	1.83e-45	79	564	80	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	3.25e-39	75	564	129	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|D4AUF1|WSCD1_ARTBC	1.98e-37	88	582	477	923	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999748	CS pos: 24-25. Pr: 0.7575

TMHMM  Annotations     

There is no transmembrane helices in PGTG_14417-t26_1-p1.