CAZyme Information: PGTG_13846-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_13846-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		55370.64	9.3425

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178310:559452-561764(+)

Full Sequence      

MKVIRSAISLYLLAYLNSINRVKADTASLRQKFSALKIDAVFPQDPNYEKFSASYNRRFT
YRPAAIVFPNNTEAVANAVKIGVAEKIPISPRAGGHSYAAYGLGAKNGVLVIDLGRINHI
SVDKTSGEAMIGAGSRLGDMALSLYNQGGRAIPHGTCPFVGLGGHAAFGGYGFTSRLWGL
TLDHIIAHEVVLTNGSIVTASSKTNPNLFWALRGAGSSFGIMTAMRFRTQSAPNQATNFV
YEWQLGEGEFANALIKLQSFCMSDLPAQIGIESNLGKGDQDGKLYMDLTGVWYGAPNGLT
SVIQPFLSQMPTPTKKSVKTRSWIASLEVSAQGQPLSTSGVDLGKEHDTFYAKSLTTPQS
IPMSNSSIIAFSKYLINQGLKSETDWFVQLELYGGKNSGVTAVGADETAFAQRSILFTIQ
FYASTSSTNPPFPAEGFTLLDNMVDSIVNNNPSGWNYGAYANYVDDRLSSSQWKSLYYKK
HYQRLTQIKQAYDPQNVFAFPQSISEPTQ

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	51	504	7.4e-92	0.9934497816593887

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	1.09e-31	56	240	25	214	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	3.13e-30	63	201	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	2.42e-11	459	504	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
178402	PLN02805	1.26e-08	63	236	134	311	D-lactate dehydrogenase [cytochrome]
215242	PLN02441	6.26e-06	1	233	1	242	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW27390.1|AA7	8.97e-119	41	504	44	490
QRW15212.1|AA7	6.92e-118	43	504	45	489
QRV86657.1|AA7	6.92e-118	43	504	45	489
QRW00715.1|AA7	5.51e-117	43	504	45	489
QRW06655.1|AA7	8.90e-110	38	508	43	499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZR6_A	6.37e-82	23	498	3	470	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	1.36e-80	23	498	3	470	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
5K8E_A	3.23e-80	24	504	22	492	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6YJO_A	1.42e-78	27	504	33	501	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
6Y0R_AAA	6.50e-78	47	504	45	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6PW77|GOOX_SARSR	8.19e-81	54	498	53	489	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|G2QG48|XYLO_MYCTT	1.66e-79	24	504	22	492	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|E9F5F1|SUBF_METRA	6.28e-79	22	504	19	489	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|P9WEY2|DPMAF_METAN	2.44e-78	22	504	19	489	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	3.34e-77	47	504	45	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001144	0.998846	CS pos: 24-25. Pr: 0.9602

TMHMM  Annotations     

There is no transmembrane helices in PGTG_13846-t26_1-p1.