CAZyme Information: PGTG_13693-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_13693-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		34887.02	8.4493

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178306:535142-536472(+)

Full Sequence      

MVSISFKSFLLLVINLQESVKSASVNRATLSKRQFDLSSLTGSLGGGSIPGIGGTSGSGS
GSGGSGLGGFPSIGSGTGGGLGGLGSGSAGGLGSFPGMGSGGGTGGLGGLSGMASGSGIG
GLGGLPGMGSGSSGTASSSNSDGASLNGQSKSQGSSGGCPSYYMIGARGTSEGPGGSIAY
NALYQKVLASVPGGAKEELQYSTSADYSVTVTQGAQTEVKMITGEISKCPKTVFVLLGYS
KGAMVQTQTLNNKEIPQDKIAAVALFGNPYFRAGAPQNKCGASSGMGIAAMAGAKMPDQL
TDRVYDCCVPGDEICQTAGSIMGHLSYAGQHENDATEFVIQKLKAKLSGATGAQKGSP

Enzyme Prediction     

No EC number prediction in PGTG_13693-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	159	343	2.3e-34	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	8.55e-27	159	343	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UMB69960.1|CE5	1.08e-22	158	344	34	212
BBX46898.1|CE5	1.01e-20	158	343	34	211
QKW12955.1|CE5	1.79e-20	159	347	43	236
AGZ42439.1|CE5	5.68e-20	159	343	20	215
BBH71387.1|CE5	5.35e-18	159	344	36	218

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CC4_A	2.32e-15	158	327	2	178	Chain A, Cutinase-like enzyme [Moesziomyces antarcticus],7CC4_B Chain B, Cutinase-like enzyme [Moesziomyces antarcticus],7CW1_A Chain A, Cutinase-like enzyme [Moesziomyces antarcticus],7CW1_B Chain B, Cutinase-like enzyme [Moesziomyces antarcticus]
2CZQ_A	1.74e-14	159	343	6	201	A novel cutinase-like protein from Cryptococcus sp. [Cryptococcus sp. S-2],2CZQ_B A novel cutinase-like protein from Cryptococcus sp. [Cryptococcus sp. S-2]
4PSC_A	2.31e-07	159	340	79	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
1QOZ_A	8.83e-07	159	343	2	206	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O06319|CULP4_MYCTU	3.73e-10	156	343	44	226	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3
sp|P0A537|CULP3_MYCBO	4.58e-09	158	345	43	228	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP38|CULP3_MYCTO	4.58e-09	158	345	43	228	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1
sp|P9WP39|CULP3_MYCTU	4.58e-09	158	345	43	228	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1
sp|C8VJF5|CUTI4_EMENI	3.67e-07	158	340	59	218	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.430206	0.569781	CS pos: 22-23. Pr: 0.5347

TMHMM  Annotations     

There is no transmembrane helices in PGTG_13693-t26_1-p1.