CAZyme Information: PGTG_12472-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_12472-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499		56777.58	7.8287

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178300:631601-633924(+)

Full Sequence      

MSPPNSPPRYNPIGWLSDLQERPLLPLRFNPLQPTNFKGRSTLGSRLITLSGLLVLIGTA
VVVDRHLFRNLGEPALLWETNYHLTNAVVSRVCNILPSSSSFASQTDGTNRTNDSFNGLL
ASKFCRNQLNQKKDLEKLYVPDSGHDFGPSMDRSMGSERCAALFPNLYQELDRAVLYHSS
RGNISIQHLDRAYQYSHARVLIYRNRVYIKGFNGGPGLRTEAILNSIQEAVITSPELLPD
VEFVIKTSDAPQGGDDEHPLWVLDRTKSQEEVWLMPDYGFYSWPEPKVGGMVEVRDKTAE
REASLSWDSKISKAFWRGAILVKLREQLLEVSKGKSWSDIKPIVWQNLNGGLKTPEDHCN
YKFLVHTEGYAYSGRLKYLLMCRSVIVGHEMQYIQHFHHLLDSRPHSPTQNIAIADGPGI
EGLPKLMDRLLADPVWAESIANNSYPLFRHYLSPAGVHCYWRQMFRAWANVQDFVPHRTP
KDTPFESFNLMHAIDWPAH

Enzyme Prediction     

No EC number prediction in PGTG_12472-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	238	472	2.2e-22	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	4.86e-25	184	480	25	331	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	7.98e-20	238	474	2	255	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76195.2|GT0	6.82e-92	152	499	57	427
QLI69899.1|GT0	1.82e-64	147	498	83	456
QSZ37094.1|GT0	2.09e-64	153	499	75	435
UDD60835.1|GT0	2.27e-59	154	468	95	417
BCR90563.1|GT0	7.92e-59	152	495	111	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.57e-17	202	474	97	381	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T045|RUMI_DROME	8.62e-17	202	474	109	393	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	8.73e-16	184	471	90	388	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	8.63e-14	238	471	137	388	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	2.04e-13	181	471	87	387	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|A0NDG6|RUMI_ANOGA	8.46e-13	138	478	44	392	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999962	0.000047

TMHMM  Annotations     

There is no transmembrane helices in PGTG_12472-t26_1-p1.