CAZyme Information: PGTG_12162-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_12162-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519	DS178299|CGC1	59387.61	9.2902

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178299:160936-162601(+)

Full Sequence      

MWKLPTSRRLWAFILVLSILVVIFWQHIFLLARILSVYPLWPIYSSSLSLSLDKDGLDTT
FEKYPVEQWSVKWPPRSANGSWPAPDSSLLRLSDGSLARLPDETYGGGVSYSEPDESDLV
PPILHHILLGMDRRRMPKTWTASRNSCLALHPESANYTHYFWDDKSAEEFMRKHYSFFLR
DFLDYRHNIQRADALRYFVLHHFGGIFFDMDLECRRSLGPLRRFAVVNINASPVGVSNGF
MMAQAQHPFLEQLIKNLKYYDRSWLGVPYFDIMLSTGPMFLSTEHLRFPASQRSTQLRVL
GGRQHRLHGSVVTPLFRHLGASSWHQGDAKLFLKIRALVYQPFFSLMLLCGFIGGSVGWL
VWKKQTTKQGVDRSWSQSSSSAGRLILWRFGFGSRRGRRRTAEEYERIEMDLESPTGMMN
NRRLSPILEDDEDLEAKSNSDLEHKQSILNFGRKRPAYNTLKSPTTPSVFMSETENLCHN
ASSSGGSCPSTSSDSDDDGSSAEAVVVLIDRHPSKWRSS

Enzyme Prediction     

No EC number prediction in PGTG_12162-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	140	222	1.6e-17	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.02e-27	107	340	69	297	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.01e-12	137	221	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFN02868.1|GT32	1.46e-160	62	455	1	420
UJR26144.1|GT32	8.25e-68	7	341	16	302
QKX57091.1|GT32	5.54e-58	104	357	62	312
VBB86275.1|GT32	1.86e-57	41	335	74	331
UNI15446.1|GT32	2.86e-57	112	335	81	296

PDB Hits     

PGTG_12162-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.93e-42	86	330	25	265	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	2.20e-42	114	331	49	258	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.46e-38	96	377	47	313	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	1.13e-32	115	329	52	259	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	5.67e-31	79	333	55	290	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000011

TMHMM  Annotations     

Start	End
13	35
340	362