CAZyme Information: PGTG_11725-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_11725-t26_1-p1
• CAZy Family: GH38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456		49679.03	6.6595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178297:736770-738628(+)

Full Sequence      

MTCKLYQVLVAACALALANQVAGLAISNDKLKPLSPAPLRIPKLPAFAGVTLSGMEFGSN
ITSQTVSKAPSNTEAANPFTLPDFDQAIHYLEDRDVSLIKLPLSWETLQHNVTKLEVYTD
VVATVTSRNAAAVVSLSMSAVQFSNFTSNVTVHKDGPLIKDVANASFVEFWGKMAAHFQH
DRRVIFHLLSIPQGGVIPRKWNETIQAAVTSIRKSGAQNAIILPSFAPSNGTTFNTFRDF
PKDFERMQHIQNPDGTTDGIVFDLAQTLGPKNAKSQRCQGVDVSDIVDPVIKILKEHKRQ
AIVGTLAGGSDPSCTRTLVKFAKVVSKSYPSLAGFVMYGAGAFDQSAPWSLIKEGEADSS
HCAEEWVDQPNFNSVQPYFPKKTKHIESSDQKPEQDSYGQKPEKESSEQKPEQESSEQKP
EEGSSDQKPGQDSSDQKPKPGSLDQQPKQAAIPNLL

Enzyme Prediction     

EC	3.2.1.4:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	47	346	1.8e-35	0.9893617021276596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.88e-08	85	225	27	167	Cellulase (glycosyl hydrolase family 5).
367362	Glutenin_hmw	0.001	393	453	287	347	High molecular weight glutenin subunit. Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.
225344	BglC	0.003	55	222	51	221	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
367362	Glutenin_hmw	0.006	369	453	509	589	High molecular weight glutenin subunit. Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY62125.1|GH5_5	1.55e-26	47	357	23	325
UNI16806.1|GH5_5	8.43e-26	47	359	23	327
AHW57399.1|CBM1|GH5_5	3.82e-25	47	351	95	396
UKZ93198.1|CBM1|GH5_5	3.82e-25	47	351	95	396
UKZ54311.1|CBM1|GH5_5	9.76e-25	44	368	93	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D8W_A	1.85e-20	47	345	24	316	Structrue of a lucidum protein [Ganoderma lucidum],5D8W_B Structrue of a lucidum protein [Ganoderma lucidum],5D8Z_A Structrue of a lucidum protein [Ganoderma lucidum],5D8Z_B Structrue of a lucidum protein [Ganoderma lucidum]
5HNN_A	6.41e-15	47	343	24	304	Crystal structure of the endo-beta-1,4-glucanase (Xac0030) from Xanthomonas axonopodis pv. citri with the triple mutation His174Trp, Tyr211Ala and Lys227Arg. [Xanthomonas citri pv. citri str. 306],5HNN_B Crystal structure of the endo-beta-1,4-glucanase (Xac0030) from Xanthomonas axonopodis pv. citri with the triple mutation His174Trp, Tyr211Ala and Lys227Arg. [Xanthomonas citri pv. citri str. 306],5HNN_C Crystal structure of the endo-beta-1,4-glucanase (Xac0030) from Xanthomonas axonopodis pv. citri with the triple mutation His174Trp, Tyr211Ala and Lys227Arg. [Xanthomonas citri pv. citri str. 306]
4W7U_A	1.48e-14	47	343	24	304	Crystal structure of XacCel5A in the native form [Xanthomonas citri pv. citri str. 306],4W7V_A Crystal structure of XacCel5A in complex with cellobiose [Xanthomonas citri pv. citri str. 306],4W7W_A High-resolution structure of XacCel5A in complex with cellopentaose [Xanthomonas citri pv. citri str. 306]
5HPC_A	1.55e-14	47	343	24	304	Structure of XacCel5A crystallized in the space group P41212 [Xanthomonas citri pv. citri str. 306]
5HOS_A	3.23e-08	47	343	29	309	Crystal structure of the endo-beta-1,4-glucanase Xac0029 from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q66NB7|EG5A_PHACH	1.57e-21	21	380	53	386	Manganese dependent endoglucanase Eg5A OS=Phanerodontia chrysosporium OX=2822231 GN=Eg5A PE=1 SV=2
sp|Q04469|GUN1_SAIFL	8.82e-20	44	359	32	329	Endoglucanase 1 OS=Saitozyma flava OX=5416 GN=CMC1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999740	CS pos: 23-24. Pr: 0.9764

TMHMM  Annotations     

Start	End
5	27