CAZyme Information: PGTG_10923-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_10923-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580	DS178291|CGC1	63401.83	6.2364

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178291:893383-896095(+)

Full Sequence      

MSDHFDYIVVGGGLAGLTVASRLSENSKLTVLVLEAGGTGIGNPGISIPGLITTTLGTEI
DWKYSTIPQEGANHREISYPRGKVLGGSSALNFIISTRAEADDYNTIERLGNPGWGWSEI
DRASKKSEKLITPPVDSGYIFNSKNHGTDGPVTNSFPKYIPPHFKPYLCASASAGHVIQN
DDPFGGKLEGAYIFPSAIDSNGSRVTSATAYYIPNQSRSNLVVRTDCEVNRLILQENDSR
SGIKVLGVEYLSDGTLSRVMAKKEVIMSAGSIGSPAILERSGIGKESVLKPLNIPITLNL
EGVGSNLSDHLFVLATYRLKPGHRTVDDLSRDPQYASEQRLIYEQSGGGLYSHAVSILDF
QSLKSIVNEDEMQQGLKLLEQCPSYMTSKQFQAVVDRIKNGVVIEFFLLNAFLEFDVPAN
RDTSYLTVGVILQHPLSRGSSHIKSQDPSAAPLIDPQYLMHPFDAWLMVQGAKHTRTIMG
QEAYKDIIVDEHYPGPSVKTNEEWEKSIRSRLSTSYHPFGTCSMLPQDQLGVVDPQLRVY
GTQNLRVVDASILPIQLSAHPAMTVYAIAEKAAEMILNKN

Enzyme Prediction     

No EC number prediction in PGTG_10923-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	578	1.2e-180	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.65e-105	1	580	4	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.53e-103	1	579	2	534	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.60e-44	435	572	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	6.46e-31	72	311	14	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.33e-22	5	577	56	577	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KIS68002.1|AA3_2	1.43e-123	2	576	56	632
SAM84677.1|AA3_2	1.23e-122	5	576	60	635
CEF78466.1|AA3_2	2.09e-122	3	577	22	594
CZS81759.1|AA3_2	5.88e-122	3	577	22	594
CEI62186.1|AA3_2	1.65e-121	3	577	22	594

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.17e-91	5	576	6	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.32e-82	5	576	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.29e-82	5	576	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	1.07e-73	3	576	4	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6XUT_A	8.36e-67	5	576	17	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	6.72e-101	5	577	47	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	6.72e-101	5	577	47	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.82e-97	1	577	10	617	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	5.31e-92	5	576	14	608	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	5.31e-92	5	576	14	608	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999876	0.000157

TMHMM  Annotations     

There is no transmembrane helices in PGTG_10923-t26_1-p1.