CAZyme Information: PGTG_10521-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_10521-t26_1-p1
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761	DS178289|CGC1	81945.93	7.3371

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178289:260609-263480(+)

Full Sequence      

MASNDSSGQRLHSTPPATTTTTIAQPFTPDQLRLIHAILDTVFHAEPTASSAEAESAGQE
PRKQQNTAARNQLFSADFSSLPDFTLADFIGYVLSSLRPAELDKFRLGLSFLSSRPITFA
LTGHYATFLEIPVDERARILAGWASSTFALKRSLFSAFVRLPISAIYSNSRLVQALIGFP
SDGDPRASSLPERRKPSYPYQFIQPPLLLDSNLPHPSARLELFETDVIVVGSGAGASVVA
SLVAKAGYQTLVIEKGRWVPTEQITGSHHGFNDMLEGNGQISTSDGNLILLLGSTFGGGT
TVNWSASLAPPFHVRRAWTEEHGLTYFGTDGFAEDIQAVCTRMGVSTSAIVHSKANQLFL
KGARTLGIHVDLIPQNTAGRAHDCGMCQRGCPFGEKQGAAQTWLKDCAEAGGKFMERGKV
ERILFSEEANPGEIEIDLKRSTPSSRRRHAVGVIVYDSRSGKRAVIRARRAVVCGSGAIN
TPALLLRSGLRLNGAVGNGLHLHPVTAVTGWFDAPVKPWEGSIMTLISCELENREGTHYG
CKLEVFASNPGFYAGLFVPWRSSGAHKAYMSRYAESFTIVVLSRDRGAGRVSLEPGTGEP
VIDYPLDPFDAESLLEGILVACRTLLAAGATEIATTLPNVQHFLAPPSATTGLDLHHRFE
EWLAEISAIGVKPGYGVLGSAHQMSSCKMGSKPSKDSVVNEKGKVWGHEKLWVADGSVLP
TATGVNPSISIMSVAHHIGNQLVKDLKDEETASDRPVSSRL

Enzyme Prediction     

No EC number prediction in PGTG_10521-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	224	753	2.7e-41	0.5161812297734628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	3.49e-61	271	505	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	3.52e-34	226	745	9	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.82e-26	585	738	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	2.38e-05	450	502	234	278	choline dehydrogenase; Validated
235000	PRK02106	5.66e-05	682	731	473	523	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	1.12e-119	26	752	24	742
CAD7196550.1|AA3_2	1.56e-08	459	760	190	514
CAD7256057.1|AA3_2	2.22e-08	459	760	300	624
AYO43781.1|AA3_2	5.36e-08	458	745	257	546
AXA50552.1|AA3_2	5.37e-08	458	745	259	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	3.47e-07	448	761	241	545	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3LJP_A	3.47e-07	448	761	241	545	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	3.47e-07	448	761	241	545	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O65709|FAO4A_ARATH	2.75e-92	124	750	88	726	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|B5WWZ8|FAO1_LOTJA	3.63e-85	226	750	238	748	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	4.95e-85	27	749	27	745	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|Q9LW56|FAO3_ARATH	3.38e-80	226	746	234	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|Q9ZWB9|FAO1_ARATH	1.53e-77	224	747	245	753	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PGTG_10521-t26_1-p1.