CAZyme Information: PGTG_09793-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_09793-t26_1-p1
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		27706.20	7.8293

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178284:33035-34041(-)

Full Sequence      

MAAITLRLIGAIHLFRLLNALLCRTYFQPDEYYQSLEIAHRLVFGYVYQSWEWRPLPDGS
TGGIRSPLHPFLFVPLYWLLRILRLDHTRLLIILPKVLQAGIATVTDLATYPLASVLLTP
SSAAAALACSLTSLFNAYAGIRTFSNSLETALTASALAYWPWNPAEISSSWANLSFSILL
IALSVIIRPSSILFWSLLGYTLLQKFNGSFSSIMHSQAGEYVSQAITCKLTEHRIPEDDR
IQIPDQTS

Enzyme Prediction     

No EC number prediction in PGTG_09793-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	12	211	2e-48	0.4524421593830334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215437	PLN02816	6.10e-33	15	199	48	225	mannosyltransferase
281842	Glyco_transf_22	8.43e-32	15	210	9	198	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA68858.1|GT22	1.67e-36	16	195	13	186
QHN91602.1|GT22	4.91e-36	14	199	43	221
CDR45799.1|GT22	5.60e-36	16	208	12	212
QHO21837.1|GT22	6.79e-36	15	199	44	221
QHO48268.1|GT22	1.14e-35	15	199	44	221

PDB Hits     

PGTG_09793-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9USN0|GPI10_SCHPO	8.51e-36	11	195	8	193	GPI mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi10 PE=3 SV=1
sp|Q6CAB8|GPI10_YARLI	6.28e-35	15	203	25	204	GPI mannosyltransferase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI10 PE=3 SV=1
sp|Q94A15|APTG1_ARATH	8.17e-33	15	199	48	225	Mannosyltransferase APTG1 OS=Arabidopsis thaliana OX=3702 GN=APTG1 PE=2 SV=1
sp|Q7SXZ1|PIGB_DANRE	5.09e-32	14	195	51	221	GPI mannosyltransferase 3 OS=Danio rerio OX=7955 GN=pigb PE=2 SV=1
sp|Q92521|PIGB_HUMAN	1.06e-27	16	196	71	240	GPI mannosyltransferase 3 OS=Homo sapiens OX=9606 GN=PIGB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995797	0.004210

TMHMM  Annotations     

There is no transmembrane helices in PGTG_09793-t26_1-p1.