CAZyme Information: PGTG_09773-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_09773-t26_1-p1
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		36618.37	5.5067

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178288:978631-980022(-)

Full Sequence      

MKCDTPLNIVPDEASAQVVIWSNPSLNLSEYDGEKLRREKPGQLHGFWSLENAGYYPQVR
EARENLAAADPSAFDFEVTYKTSSDFPIPYAYGFMDTKKAALPFEARRQDKIAAAFISNC
NPLNNRTEILKKLIDLLPDQIDSFGGCLQNADSDKVVQQLNLNPLVPGQPHHNLSRWEEK
MSIIGRYKFTIAFENTNEEDYVTEKLSMPFNTDSLSLTSVQFAKFKPSPDSALNVADFKT
VEELADRIKKIANDRALFEAALEWKNQPFPERFDEIIGWGKIHEACRIAKFLRKEWRNPH
ALKQERYESFYQRLNLTTP

Enzyme Prediction     

EC	2.4.1.214:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	15	298	8.6e-42	0.7492795389048992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	2.57e-21	110	295	2	162	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR42991.1|GT10	7.66e-47	3	265	122	410
CAC78980.1|GT10	1.74e-32	39	292	157	381
AAK96713.1|GT10	1.74e-32	39	292	157	381
AAO00930.1|GT10	1.74e-32	39	292	157	381
AAG13053.1|GT10	1.74e-32	39	292	157	381

PDB Hits     

PGTG_09773-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FX97|FUT12_ARATH	3.09e-33	39	292	157	381	Putative fucosyltransferase-like protein OS=Arabidopsis thaliana OX=3702 GN=FUT12 PE=2 SV=1
sp|Q9LJK1|FUT11_ARATH	6.74e-32	40	292	147	370	Glycoprotein 3-alpha-L-fucosyltransferase A OS=Arabidopsis thaliana OX=3702 GN=FUT11 PE=1 SV=1
sp|G5EEE1|FUTE_CAEEL	7.56e-16	15	303	106	372	Alpha-(1,3)-fucosyltransferase fut-6 OS=Caenorhabditis elegans OX=6239 GN=fut-6 PE=1 SV=1
sp|Q5F2L2|FUT10_MOUSE	2.57e-15	74	296	167	373	Alpha-(1,3)-fucosyltransferase 10 OS=Mus musculus OX=10090 GN=Fut10 PE=2 SV=1
sp|Q6P4F1|FUT10_HUMAN	8.40e-15	74	265	167	354	Alpha-(1,3)-fucosyltransferase 10 OS=Homo sapiens OX=9606 GN=FUT10 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PGTG_09773-t26_1-p1.