CAZyme Information: PGTG_09416-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_09416-t26_1-p1
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		45177.20	9.9471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178287:519240-520575(+)

Full Sequence      

MSTLTKIVLLSILVRLISFLLLLLTNPLLISSFDHSAQSNTTIIINSSHSSDGTPSTSSP
PTPEQQTATASILSTLILYQLTLKLSSHSTSYSALVGLLHLFSPSPSTQVVPYTEPFYAL
FSFAAIYLIEAKHHWPAAILAGIATSFRPIGVIQCLLWIPQWTNHLKQLINNPKQSSALI
RFISTSLKTLLLALITSAPFIYDQYSAYKHYCYQSSSPRPWCSNRIPSIYTFVQSHYWNN
GFLNYWTFNQLPLFIISFPIYWASFAGIWNYYGSTRFTTPKTHQSKPDEARSIIKQSGYR
PFLDPRLQIHILIQLLLTSLLLFNSHVQIILRQIATIPAFWWGLADGISRHWNQQQSSNQ
HNSHRIARSYWAWWFPWIVVWAPISLVLWAGFYPPA

Enzyme Prediction     

No EC number prediction in PGTG_09416-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	69	396	6.2e-64	0.7248157248157249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.94e-25	72	396	123	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	4.36e-12	69	276	125	321	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED83330.1|GT76	3.25e-43	69	396	81	422
EAL22094.1|GT76	2.45e-36	70	396	113	423
AAW42711.1|GT76	3.40e-36	70	396	113	423
KGB77682.1|GT76	1.74e-35	70	396	113	423
ADV21212.1|GT76	2.42e-34	70	396	113	425

PDB Hits     

PGTG_09416-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP63|GPI18_CRYNB	4.35e-37	70	396	113	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|P0CP62|GPI18_CRYNJ	6.04e-37	70	396	113	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	8.09e-27	70	396	117	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	2.40e-25	69	396	147	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	3.18e-22	67	396	95	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.281080	0.718908	CS pos: 32-33. Pr: 0.6289

TMHMM  Annotations     

Start	End
7	29
137	159
179	201
251	273
371	393