CAZyme Information: PGTG_09220-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_09220-t26_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721		82640.82	7.2502

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178285:784645-787713(-)

Full Sequence      

MARLLTLPGKLRSRRSIKRIFIVSSWLFVLHELYSFLTHHRSTLPFINPSQQSLESDYIL
PPHPIQTRLESARQRWKDKLNSQSVDYAQFKAKYRKKYNLEPPEGMREWFKIVSADGVLL
VDEFDSLMASLKPFRIMSPEELHRRTLEVAAMPTFSLLNITDAHAHFYGQNYRDDFAHYS
RENYGPGIERVEGLASMMQRHIHRVPNGLIFAVSELAEPRVIVPWQDHPTTIESFELETL
SMHKKDYSQQLKPIEMKKLLPSPAFGDSGNTWELYAKSCPPESSARKKLLSLTPDNAPAQ
HRDHFVDHHNDPIHVKRGKLKTGLKKRRSPGNLTRSSLEIPDSGANDGPPKGFPTATLLQ
ESDEFKFVEVGKAGLSHEELCSNSELHENQGAFYSDWRSLPALYPVFSPSKIDGFSDILI
PSNFYYGDDARYTFQRNETIPWEQKKSNLFWRGETTGGGNSPPGHQLQYQRHRFVRLAGR
VSDVLKSLLVADPRSGMIRHIKRTITELNQAWLDIGFTGYTGCGDPKICILTEQLCPLKK
TVPLKEMAKYKAILDLDGMAFSGRFVALMNMGSGVFKSSIYKDALTEWIEPWVHYIPIGG
EYSELYNLLAYFLPLDDKEEQTKSKKNWVRRLWDTTLHKKAEGDEQLRQIAEDGLKWSEN
VGNKQDIEAYVYRLSLEWGRMMGKIGDEEVDPDEEVENDPSTIFDSLGPSQRYLAPDSKD
N

Enzyme Prediction     

No EC number prediction in PGTG_09220-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	384	682	4e-54	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.67e-21	401	626	28	224	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.32e-04	537	598	203	265	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB77320.1|GT90	7.03e-106	25	681	20	628
AAW46283.1|GT90	3.82e-105	25	682	20	629
AAD44757.1|GT90	3.82e-105	25	682	20	629
ADV25019.1|GT90	5.37e-105	25	681	20	628
AFR94064.1|GT90	2.22e-103	25	681	20	628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	2.21e-08	401	621	115	309	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	5.38e-06	405	716	154	401	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	6.41e-31	63	681	152	655	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	4.24e-08	405	621	146	337	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.31e-07	401	621	143	337	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q8BYB9|PGLT1_MOUSE	2.30e-07	405	617	146	333	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2
sp|Q5E9Q1|PGLT1_BOVIN	5.34e-07	401	621	143	337	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000005

TMHMM  Annotations     

There is no transmembrane helices in PGTG_09220-t26_1-p1.