CAZyme Information: PGTG_08849-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_08849-t26_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706	DS178283|CGC1	76033.80	7.0451

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178283:428022-430607(-)

Full Sequence      

MRLPRLLSSSLYVIYGSSYLSGSQASETSSTETVGRRTTPATAHHTLKSFVSRRVDLRQE
YPLRMCMRPTEGKKAEGGGGGGHQRRELAAVSYPFTFSNLVSPRARLGQLIVNPSPYLEP
APNVLLPLGPKNSPNANRQSQLLPQQQTLPLPLPLPQPALVPAPSLSVGSPPLLDVSLPA
APPGPITISYFPDWSLDILAPEQVQYKKFDIIYFAFAIPNENVGVDFTQPDSKQTLDRLV
SGAHAAGSRVVLSVGGWGGSKFFSVAVKSECSRQTFVNNLYQLVLAHDLDGIDIDWEYPG
QAQIQDNIASSTDSAALLSFFQLLRAKLGPHKIISAAVTDYTFTNAQGGRMTNVEEFGKV
LDYILIMNYDVWGASSNPGPNGPFSNGCQDSSQPGANMVSSIKTWTSAGFPRQKILMGLA
AYGYINHASTTTLVHRKRSEIPQPARRIDQYLVQADNRQLRNRQNSCLDPTGVTCSILNA
PPVPLNIVQIPSLNLVPQSLVQTPSASLNQTSSLPSTVQDALPSVNQTVTAISPNLTQTV
DPPNVSNLTQTVDPTNVSNLTQTVDPNLTATTGPTLFDAGQNDTSGLLRKASSAIGSGDL
DGHSGNQIQFTDLFKWGIVQLDLSDNEGRLTGINGYQVAWDRCSSTPYAFSKARNIVITY
DDTISIGIKASYALAAGIGGVGFWDMTGDHHAMLIDSARKNLAMVD

Enzyme Prediction     

No EC number prediction in PGTG_08849-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	188	428	4.8e-42	0.668918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	8.52e-46	188	447	3	256	Glyco_18 domain.
395573	Glyco_hydro_18	2.05e-38	187	424	2	225	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.33e-36	188	423	2	263	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119357	GH18_zymocin_alpha	3.28e-34	188	423	3	242	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
119349	GH18_chitinase-like	4.19e-31	188	371	2	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR49082.1|GH18	3.69e-94	182	689	295	762
QRV87962.1|GH18	9.01e-81	185	704	122	506
QRV73087.1|GH18	9.01e-81	185	704	122	506
QRW02133.1|GH18	3.06e-80	185	704	156	540
AGV14596.1|GH18	2.59e-77	186	704	447	826

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	1.74e-30	189	426	6	239	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6TSB_AAA	1.51e-19	201	441	46	280	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	1.88e-19	201	441	65	299	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6G9C_A	4.15e-17	201	445	54	293	Crystal structure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9C_B Crystal structure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9E_A Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_B Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_C Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_D Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_E Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_F Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis]
4AY1_A	7.02e-17	188	424	5	246	Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_B Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_C Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_D Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_E Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_F Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_G Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_H Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_I Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_J Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_K Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens],4AY1_L Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	1.86e-17	201	423	400	613	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q15782|CH3L2_HUMAN	4.57e-16	188	424	30	271	Chitinase-3-like protein 2 OS=Homo sapiens OX=9606 GN=CHI3L2 PE=1 SV=1
sp|Q5AM60|CHI4_CANAL	6.09e-15	187	427	24	267	Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT4 PE=3 SV=1
sp|P32470|CHI1_APHAL	1.85e-14	249	423	123	294	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|P11220|CHIT_STRPL	2.66e-14	249	423	334	508	Chitinase 63 OS=Streptomyces plicatus OX=1922 GN=chtA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.695284	0.304714

TMHMM  Annotations     

There is no transmembrane helices in PGTG_08849-t26_1-p1.