CAZyme Information: PGTG_08072-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_08072-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		40800.05	6.5569

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178280:264135-265633(+)

Full Sequence      

MAGSSHHQSSSSGSSPWLVIALFISLTLFLTQILPNITTTGTAFRSQFPGWPGSGTALSR
LQDKNNGLRTTTTTTTTGMVEALQAQLPSFSSVRVVSLNSRTDRRMHMQTLADFLQLDNL
HFVDAVLYSDPRVLEIVQRIGNNTKADKKIAEVGHVACRMSHRLAIEAADTDDDEITLIL
EDDVDIEAAFKYLAGTILRDVPKDWDIIFFGHTDFSNEARNGPDPSTNNFYIYKSVEPQG
GHGYALSRKGRKLVLDLMDNKRPEVYETDEGQPVDEIFVYLARLHRAALYSIIPDLIVQV
PLFVSDIFGTPAGFDDGMHAKKLLDSSLTRIAAAAASSHLSPLNHPVISQSPALGHSLSR
RTSHRHAYTQ

Enzyme Prediction     

No EC number prediction in PGTG_08072-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	92	258	1.7e-20	0.9226519337016574

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225843	COG3306	5.80e-14	89	308	1	218	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
133474	Glyco_transf_25	2.18e-11	95	207	4	128	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	1.23e-09	95	257	6	188	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL40939.1|GT25	1.22e-124	87	341	89	342
QRW05723.1|GT0	5.85e-14	154	308	213	365
QRW19667.1|GT0	6.74e-14	156	308	323	473
QRV91652.1|GT0	7.29e-14	154	308	247	399
QRV76825.1|GT0	1.31e-13	154	308	247	399

PDB Hits     

PGTG_08072-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7Q021|GLT25_ANOGA	4.54e-11	89	274	317	503	Glycosyltransferase 25 family member OS=Anopheles gambiae OX=7165 GN=AGAP012208 PE=3 SV=4
sp|Q5U483|G251B_XENLA	1.39e-08	89	291	328	527	Procollagen galactosyltransferase 1-B OS=Xenopus laevis OX=8355 GN=colgalt1-b PE=2 SV=1
sp|A0JPH3|G251A_XENLA	4.34e-08	89	291	328	527	Procollagen galactosyltransferase 1-A OS=Xenopus laevis OX=8355 GN=colgalt1-a PE=2 SV=1
sp|Q17FB8|GLT25_AEDAE	2.37e-07	91	274	323	507	Glycosyltransferase 25 family member OS=Aedes aegypti OX=7159 GN=AAEL003481 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999999	0.000045

TMHMM  Annotations     

Start	End
15	37