CAZyme Information: PGTG_08011-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_08011-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		39236.92	9.8015

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178279:1173515-1175565(+)

Full Sequence      

MVSHKQVRQNLFIAAFFSLSAWAQSSPPTGALIVRQGSSTSRGEFSTISAAVASLARLTG
PQTIFIYPGTYTEKVKITYPYSLSVQGYSANPTSTASNQVTVNAAVSAAQAGSNSNSATI
WAHSSGIRISNLNIINSFGTGRDTQALALASTGNRQAASRIPLKSEGTAYFYGSHIEGAV
GGCSALLTSLNYFDILGKQGNVLNQTKSYPSQCTNQFLPFSMHLLPLACYALDFIFGPGS
AWFESVVLGVKSSPTPVITAQRNSPGGGTAFVFNHAQIVSAGAKPGSAYLGRPWSPDASV
VYQFCSLSNVINPQGWKIWSPSQPNTDRVNFQEFQNVGPGASTSARQIGTQRSAQVNIAS
ILGSDYSTWAQ

Enzyme Prediction     

No EC number prediction in PGTG_08011-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	231	347	3.6e-29	0.4027777777777778
CE8	40	179	1.7e-19	0.4965277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	5.21e-24	31	346	10	265	putative pectinesterase
215357	PLN02665	7.48e-21	23	346	63	333	pectinesterase family protein
215367	PLN02682	5.05e-19	28	346	67	340	pectinesterase family protein
178113	PLN02497	4.48e-17	1	346	1	299	probable pectinesterase
227022	PemB	5.49e-16	11	362	57	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL40912.1|CE8	2.77e-65	27	364	37	332
ALL41233.1|CE8	5.40e-49	27	364	37	304
AFO55205.1|CE8	6.66e-49	11	369	7	314
AEO66258.1|CE8	1.13e-46	23	369	25	327
ARB08121.1|CE8	3.26e-44	9	369	4	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	2.25e-27	23	369	2	294	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.11e-27	23	369	2	294	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	1.87e-10	232	346	156	278	Pectin methylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	2.17e-37	9	369	3	325	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|B0Y9F9|PMEA_ASPFC	3.80e-35	24	369	28	319	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	3.80e-35	24	369	28	319	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	5.44e-33	24	369	28	319	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|P17872|PME_ASPNG	8.72e-32	9	369	3	324	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002400	0.997551	CS pos: 23-24. Pr: 0.9239

TMHMM  Annotations     

There is no transmembrane helices in PGTG_08011-t26_1-p1.