CAZyme Information: PGTG_07989-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_07989-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		47283.12	9.6618

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178279:1097652-1099873(-)

Full Sequence      

MHLVCRARMMIHVVWLGCLIITTSTLSISSSRTHHARQLQPSGNRPPFVTPPSVNDINGN
GRGSRFFNVSNLPPPTIIVRQNTTHPKEFRTIQGAVNSLKDRNGPQVIYIHDGIYREQVY
VDYDPPLIIHGRKPSDNGQNSVSLVFALGAKEAKSNEASATLNVIKNDFGLYFVNVTNEY
GTGTDTQALAINAKGDRQGFYSCSFKSFQDTVRAYRGIQLYSRCEISGAVDFIFGRDANA
WFEQVTIPILKGSKEPITASGRHSNDTAGFYVLNNATVYSAGALPGTAYLGRPWRGGAKV
AYQNSYLSDVINPDGWLAWSPADPRTESVQYQEFGNFGPGAQGKRLYDTPLRSPHLPENI
LGPDYLDWIDYSYRPILTSPDPTKRMNTLGIKKDATDSSPTTNTLIVKQEPNPPSSARTR
RFKTRSS

Enzyme Prediction     

EC	3.1.1.11:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	85	346	3.2e-67	0.8958333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	1.29e-41	89	345	44	298	probable pectinesterase
395871	Pectinesterase	4.04e-40	89	345	12	271	Pectinesterase.
178051	PLN02432	1.01e-38	75	341	9	260	putative pectinesterase
178098	PLN02480	5.33e-36	76	342	49	308	Probable pectinesterase
215130	PLN02217	1.88e-34	60	416	234	602	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX54343.1|CE8	6.77e-69	88	373	35	326
ALL40912.1|CE8	1.92e-68	61	362	25	331
SMR44940.1|CE8	7.92e-68	88	373	36	328
AEO66258.1|CE8	1.26e-67	88	373	41	332
SMR42769.1|CE8	3.12e-67	88	373	36	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.67e-57	89	373	19	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.35e-57	89	373	19	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	2.96e-24	88	350	14	278	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	2.15e-21	88	341	18	273	Pectin methylesterase from Carrot [Daucus carota]
2NSP_A	7.18e-16	78	294	7	245	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	2.32e-59	88	373	36	329	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q5B7U0|PMEA_EMENI	3.89e-59	89	373	45	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|A2QK82|PMEA_ASPNC	1.88e-56	89	373	47	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q12535|PME_ASPAC	6.25e-55	88	373	36	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A1DBT4|PMEA_NEOFI	3.96e-54	88	373	43	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.069515	0.930450	CS pos: 27-28. Pr: 0.7028

TMHMM  Annotations     

There is no transmembrane helices in PGTG_07989-t26_1-p1.