CAZyme Information: PGTG_07926-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_07926-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	DS178279|CGC1	47864.78	6.6071

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178279:835444-836706(+)

Full Sequence      

MAGDPHLYPQSQITRISRGHINGWDPDVEDFLYDEDMFVSIDHTIALAAQYNVRLIIPII
NQDFGSEDTNWVGNFTDLIRHRRGHRKDCHGQDWWRDEECLDSMKKIVSFLLNRVNTFTG
VRIGDDPTILAFETGNEMNCGGLRPAPGDWTLEIARHIKSLAPRALVMDGSFARTDAIEH
SHDHQALRSELVDIISWHYYGYGEKRRVEEDVKAARAHGTAFICGEYGFFAHGREFESFL
KHCDRHGACGTLAWSLRPHSAKGGFKTHGEGNDIWSYHAPGWKPARLSTGHHPEWDHRER
DVIRAIRKAAFDLTNQKPPPIQPEHPPELFLCSDGESFTWRGVAWADYYELWLSPVGQGE
QEWKFFQGGITDNIKEGHLKYCAANILRLKRCNSLWIIMRGISADKLPGPFSQPLQIGGS

Enzyme Prediction     

No EC number prediction in PGTG_07926-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	20	264	1.1e-47	0.86328125

CDD Domains     

PGTG_07926-t26_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR43041.1|GH5	2.21e-114	16	417	115	514
ALL41339.1|GH5	1.34e-73	20	338	6	348
AYQ73430.1|CBM23|CBM61|GH5	1.05e-44	26	377	130	469
ABR27262.1|GH5_41	1.50e-44	33	372	105	410
UJF31796.1|GH5_41	4.62e-44	33	358	112	428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZ9_A	8.25e-18	6	228	78	309	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	1.98e-17	6	228	64	295	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]
4QP0_A	2.20e-12	41	170	89	218	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]
1RH9_A	5.64e-09	32	170	78	213	Chain A, endo-beta-mannanase [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5W6G0|MAN5_ORYSJ	3.29e-14	32	171	150	285	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2
sp|Q9SG95|MAN4_ARATH	3.37e-12	33	170	103	237	Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana OX=3702 GN=MAN4 PE=3 SV=1
sp|Q2RBB1|MAN7_ORYSJ	9.41e-12	31	262	79	350	Mannan endo-1,4-beta-mannosidase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN7 PE=2 SV=3
sp|Q9FJZ3|MAN7_ARATH	1.16e-11	33	170	104	238	Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana OX=3702 GN=MAN7 PE=2 SV=1
sp|Q0IQJ7|MAN8_ORYSJ	1.62e-11	31	262	72	343	Mannan endo-1,4-beta-mannosidase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN8 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PGTG_07926-t26_1-p1.