CAZyme Information: PGTG_07656-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_07656-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		40992.23	5.8063

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178281:938135-940087(-)

Full Sequence      

MWISKHRTCNRFIRFVVSPLLVITKASCLVDSPSDPSELQESFQPSWTNYSAFIVFGDSY
SDNGHPRSPEDQPSLAAKPAVGGRFCDGPVWDEYLAQNLSNSADSNITFLNYAYNGAHIR
NKLSNQSPSPVPDTAAQIQTYLTDLEKYVQHPISGKVFEGRILHALWIGINPILSIWRSA
SSGNQTLNADTLLTPELAETLNTQVEEFSKQLLLLSNNPSLSKFQTDYMVMTIPPLTNTA
LALSQSSQASKGDVTLAQQYIELLAQMTDHFNTKLVEAVQKMTRQFSWHKRRITVFDTVD
FWDDVRSAPQRFGIQSLGSCYTDPNKPPCKKPDLYMYWDILHPSSIFHANLSNAIMQFLD
ELNE

Enzyme Prediction     

No EC number prediction in PGTG_07656-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	53	354	2.1e-25	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	2.88e-38	53	358	2	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
225780	COG3240	4.83e-15	44	359	23	333	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	1.59e-12	50	353	1	275	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
238875	SGNH_plant_lipase_like	1.81e-12	52	344	2	300	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	4.37e-05	54	355	2	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
URD49815.1|CE0	3.35e-15	48	359	31	290
UQO47878.1|CE16	1.89e-12	54	358	185	444
UQO34384.1|CE16	1.89e-12	54	358	185	444
UQP09783.1|CE0	1.89e-12	54	358	185	444
BDA67938.1|CE16	2.10e-11	55	360	38	285

PDB Hits     

PGTG_07656-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P10480|GCAT_AERHY	5.98e-06	50	364	25	331	Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila OX=644 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.018847	0.981145	CS pos: 28-29. Pr: 0.7008

TMHMM  Annotations     

There is no transmembrane helices in PGTG_07656-t26_1-p1.