CAZyme Information: PGTG_07512-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_07512-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626	DS178281|CGC3	72203.58	7.9752

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178281:373764-376737(-)

Full Sequence      

MAGIRRLLLFTTLLLSLSILLIFYSSSTTNTNNSLPTSASSLAIQDRLKGYLPNKETLKT
YVPKPFKWSNWATSDAVKLEDSLITTTTTNQQQQNSNKHNNQSTSQTNQSTLPTNYHPNG
LYYLSQPPPLERHPILDLIDKAEQEWANKVAKSSRSLEEAVAEYRRRYHQPPPFGFEKWW
EYAQKEGVILTDEYDQIGADIKPFLAIEPSDLLHRAWVMANERPETFTLTINSTAPVLIS
GKEGHLARAKDLAKLINLFVHLLPQNSGSINHLLNLTFTKHDQPAVQMTWPRKQKMVEMA
EAGEYFFALGLYKTVEPEAKQLGECMTQSDILVTPLEQYSDTYIGDDPEWSKKKITKLLW
RGSTTGAEFRSDVDWRASQRARLHLMAHHSNGSTHILSPDDSLTRIVSKDIESLNHKLLD
VSFSGGPVQCDPVTCEYMHTHLKFAGTMGLDESYQYKYLMDVDGNGWSGRFHRLMSTKSL
VLKSTIFPEWYSDRIQPWVHYVPIKVDYSDLYDVMVFFQGEEEEEEEEEMNKDPNSRPTK
RSPERKRKRSRRDGDGGRERYNQHQKRKTKKNTGHDQLAEKIASQGKRWAAEHWRRTDMA
AYMFRLVLEWRRVMLRGTGEPLDYFG

Enzyme Prediction     

No EC number prediction in PGTG_07512-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	344	614	1.2e-60	0.772

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	6.32e-14	448	615	138	254	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.14e-07	455	610	215	319	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
177640	PHA03412	0.002	291	404	76	182	putative methyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40950.1|GT90	1.41e-140	113	624	145	702
CDR40723.1|GT90	6.92e-125	116	624	195	714
CDR48932.1|GT90	3.27e-89	129	624	167	694
QRV89460.1|GT90	2.61e-87	109	614	111	640
CDR40913.1|GT90	1.85e-86	132	626	241	754

PDB Hits     

PGTG_07512-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	4.15e-64	133	624	152	667	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q197C5|VF179_IIV3	1.03e-06	350	513	305	446	Uncharacterized protein 035R OS=Invertebrate iridescent virus 3 OX=345201 GN=IIV3-035R PE=4 SV=1
sp|Q7ZVE6|PLGT2_DANRE	8.87e-06	348	523	295	429	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.990814	0.009195

TMHMM  Annotations     

Start	End
7	29