CAZyme Information: PGTG_04243-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_04243-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618		67303.73	4.9314

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178270:40656-43124(+)

Full Sequence      

MGADPLSAIHEEQRHFEIPTIPVFGSIFEGKTYDYVIVGAGTAGMTIAARLSEDPTIHVA
VVEAGIDYALSPANKPLVDTPGADTLGCGSKQYDAINDAVDWRFDTTPQSGANNRIVRYA
RGKTIGGSSARNFMIYQRASKGSLDKWAELTGDPDWTFEKRFADYQKSVSFTAPKHDLRQ
ELPEARYDDLAFTQANGPVQLSYPNMAQPFSKYMQLSLNEKGIPTCQDFNGGTLSGVQYS
SATIDPKDGHRSTSRAFFAAARSRSNLVVYTTAMVKRIIFDESTPPRAEGIEFVYTLTGV
SDKLLAKKEVIVSAGAFQTPQLLMVSGIGPKDQLTANQIPILVESPNVGQGMQDHIFFGP
TYPVHSIETLTRVAAHPEHLASQFVNFTLRQLGPLTNNVADMIAFEKFDESKLEQLNSDS
LSGYPTDWPHVEYLSAAGVVGDFANLLTSNALAGAATGKEFVTILAALVAPQSRGTVKIA
SNDASVPPLIDPAWLTDPVDQRIAVEAFKRTREFFSAEAMQPILDGQEYLPGPSVTGDDQ
ILDWIKNNLMTVWHAACTCSMRTQEQGGVLDSHFRVYGTQSLRVVDASAFPSLPPGHPQS
TVYMIAERAASLIQEENS

Enzyme Prediction     

No EC number prediction in PGTG_04243-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	31	615	5.9e-182	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.69e-99	31	613	4	531	choline dehydrogenase; Validated
225186	BetA	4.73e-99	30	617	5	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.63e-43	471	609	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.64e-34	22	605	45	568	Protein HOTHEAD
366272	GMC_oxred_N	1.32e-26	112	355	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SAM82705.1|AA3_2	4.92e-204	32	617	44	629
ULM60686.1|AA3_2	9.59e-203	66	613	3	560
SJX63486.1|AA3_2	4.73e-197	2	617	19	631
CBQ73647.1|AA3_2	9.49e-197	11	617	30	631
CDI54067.1|AA3_2	7.40e-196	32	617	45	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.86e-73	33	616	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.74e-72	33	616	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	9.12e-67	32	616	5	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	7.79e-64	31	617	4	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
2JBV_A	1.98e-58	31	614	12	527	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	7.63e-145	31	610	49	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	1.52e-144	23	610	39	621	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	2.02e-143	28	617	36	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A1U8QYA8|CICC_EMENI	5.12e-125	24	613	27	607	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q12062|AFLK_ASPPU	7.93e-123	30	611	72	637	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999980	0.000050

TMHMM  Annotations     

There is no transmembrane helices in PGTG_04243-t26_1-p1.