CAZyme Information: PGTG_03848-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_03848-t26_1-p1
• CAZy Family: GH10
• CAZyme Description: dolichyl-diphosphooligosaccharide-protein glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	DS178268|CGC4	90848.80	9.4694

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178268:1792170-1794972(-)

Full Sequence      

MSLNTIYPLISLTPQTNRNVLAFLRLVIVCLIAGAAVSSRLFAVIRHESIIHEFDPWFNY
RASKILTEQGFHAFWNWFDQTAWYPLGRVVGGTIYPGLMVTSGLIWNVFRLFNIPIDIRN
ICVLLAPGFSGLTAYATYLFARELGQKTNSKGAAQTKTVGETGEGTGLWAALFIGIAPGY
ISRSVAGSYDNEAIAIFILMTTFYLWIKALKQGSALYGSMAALFYFYMVAAWGGYAFITN
MLPLHAFVLILMGRFTNKLYVAYSSFYAIGTLASMQVPFVGFQPIRTSEHMAALGVFGLL
QLVAFVELVRSHVSSKQFKLLLQIGVTSFGVLAFGALVFMTKQGWIAPWTGRFYSLFDTG
YAKIHIPIIASVSEHQPTAWTSFFFDLQMLIYLFPAGVYLCFRELRDEHVFVIIYSVLGS
YFAGVMVRLMLTLTPIVCIAAAMIVSSIFDLYLDPAQPDSVDFGTPSTTSSIESSSPIES
FGSSASSSGSAPGSARKPKKGHSAASSISSVSSVGSVKSTRSTRSSASSASSAYTQVPCI
SAIYGSDTRLALVSAFTFMLLLFVLHCTWVTSTAYSSPSVVLASKNPDGSTNIIDDFREA
YYWLRMNTKKDAKIMSWWDYGYQIAGMADRTTLVDNNTWNNTHIATVGKAMASKEEVSYP
ILRKHDVDYVLVIFGGLLGFSGDDINKFLWMVRIAEGVWPSEVQESSFFSARGEYKVDDE
ASSTMKNCLMYKMSYYDFDKLFGGQRAQDRVRGQVLPQVGPSLDTLEEAFTSENWIVRVY
KVKEEDFLGRNHKDAKAFLAGKKKKAGASRKRKNRRQSRA

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	23	737	1.3e-180	0.8484848484848485

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	2.05e-135	23	455	1	419	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	3.10e-97	24	790	19	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR48162.1|GT66	0.0	1	805	1	777
CDZ98017.1|GT66	0.0	7	805	8	755
QRW02713.1|GT66	0.0	7	805	5	739
QRV73765.1|GT66	0.0	7	805	5	739
QRW16703.1|GT66	0.0	7	805	5	746

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	8.88e-303	24	794	16	694	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	2.60e-271	14	786	65	776	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6S7O_A	4.79e-251	24	789	18	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTG_5	1.93e-250	24	789	18	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6FTJ_5	8.03e-250	24	784	18	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	1.89e-307	24	805	24	738	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	4.57e-302	24	794	16	694	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|E2RG47|STT3B_CANLF	4.71e-271	14	786	65	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	1.34e-270	14	786	65	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	4.87e-270	14	786	62	773	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000005

TMHMM  Annotations     

Start	End
21	43
86	108
121	140
167	186
193	210
230	252
259	281
291	313
320	339
380	402
409	427
431	453
550	572