CAZyme Information: PGTG_03346-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_03346-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		49281.21	9.8726

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178267:1513712-1515762(+)

Full Sequence      

MSDHLKATLKYCRRILVSKEQYDLIAGLVLLSELVLNTAIIKYVRYTEIDWIAYMQQIRS
YSLGERNYLKLKGDTGPLVYPAGFVHVYSVLYSLTQQGQDVKLAQYLFGAIYLITMGFVL
AIYKRCESLPTYAIFSLILSKRMHSIYVLRLFNDGIAMMGLYVSIWCLVTQRWNWSALWF
SLALSIKMNILLFFPALGFIYFQTVGVLKTINLMLIIVLVQAWLAIPFLLEFPREYLSKA
FEFKRVFEYQWTVNWRMVPQSTFLSSGFASSLTLLHLSTLVWFAWTRWSRASRGDSLISL
LVRGLRNWNRPAAIHPDQLTPDYIVKVCFTSNLIGIICARTLHYQFYSWYAHQIVFLAWQ
TPYPIFLRILLMLSIEYSWNVFPSTSISSTVLLLSNTSLLVGTWWSFDQSCSATPVAVKK
KHKVT

Enzyme Prediction     

EC	2.4.1.258:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	28	389	4e-134	0.9917582417582418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	28	389	2	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08832.1|GT58	9.07e-104	3	402	2	395
QRW13371.1|GT58	3.06e-98	3	402	13	409
QRV98819.1|GT58	6.10e-98	9	416	19	423
QRV84772.1|GT58	6.10e-98	9	416	19	423
UIZ28023.1|GT58	1.20e-96	18	401	39	413

PDB Hits     

PGTG_03346-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q55F69|ALG3_DICDI	2.54e-97	25	401	21	419	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1
sp|Q8K2A8|ALG3_MOUSE	1.75e-89	13	406	32	423	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg3 PE=1 SV=2
sp|O82244|ALG3_ARATH	1.75e-89	30	404	40	416	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG3 PE=1 SV=1
sp|Q92685|ALG3_HUMAN	1.75e-89	13	404	32	421	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG3 PE=1 SV=1
sp|Q27333|NT56_DROME	8.91e-86	10	402	33	483	Lethal(2)neighbour of tid protein OS=Drosophila melanogaster OX=7227 GN=l(2)not PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000005

TMHMM  Annotations     

Start	End
24	46
76	94
104	123
147	169
179	201
208	230
263	285
348	370
385	407