CAZyme Information: PGTG_03309-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_03309-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	DS178267|CGC1	36389.68	9.5373

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178267:1353144-1354837(+)

Full Sequence      

MQQILLLSVLLFASHCVGEEPARTELAAGNSVPKAGKYAAPTRKSVAKAVQRLFDFALTP
DMKTADLDVPKTAVNKLIGYVVKGPAKPSAYLSILHPSPTKIQLAIRDDSIFIPGGKPAD
AQRGFRRTDVNPAIDKTTTLTGVTTWYQTIRLDSKAPLALSHGYLFASIEVPSGDHIFDI
FGGSYFNPKNIYHQPMSNSRTIRVRDFQGKTLLSLPLKYDQNYNFAVTVDWIQNTLTVYS
SIGTDPLKKAVGPMYNDPKAISPEFKHKGEYHLQLLKYPLPDAKIPAEKRLDVPHFGFQE
PIKQEHVSFSNVFVTSGTQIEQPEFSDQ

Enzyme Prediction     

No EC number prediction in PGTG_03309-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	59	318	6.6e-28	0.9372549019607843

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.40e-50	53	318	2	249	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL40783.1|GH131	4.22e-36	55	311	29	289
QRV95300.1|GH131	1.21e-34	53	316	22	296
QRV80910.1|GH131	6.65e-33	53	316	22	296
QRW22550.1|GH131	1.24e-32	80	318	45	296
QRW09714.1|GH131	2.52e-32	80	316	45	296

PDB Hits     

PGTG_03309-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PGTG_03309-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000660	0.999314	CS pos: 18-19. Pr: 0.9413

TMHMM  Annotations     

There is no transmembrane helices in PGTG_03309-t26_1-p1.