CAZyme Information: PGTG_03208-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_03208-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		47402.45	5.8921

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178267:899790-901872(+)

Full Sequence      

MLSCFLTILTATTLLSFTKSEPFEPSPPPPMHQDHVIIGYYQFSHAQYQRLENVAWGRYT
HMVFHGAWPIDQFEFTFGSDDQNQQAIQYMQPFVQYADQNNVRPLLGMGGEQGSKLFSYY
LSDANRRSTFVQNLVSLAQTYNFQGVVVTWLAPNTPGVGCNTRSPSDTVNFGHFAQEFKK
VWKQGRLIIRANFNGFIGATGNYATSEETSLIAQNVDYIDLMAFDGYTGNRGARTGPFSA
LTADCPKIPYLSNGIKELLQIMQFQGFSVNKLILGFTGYGRVFYLPKHFNMKTDISQVAY
GAAPPGGWTDNLNGTLDACGQYRGFEGIYLLNELLEYGWLESDGVTATQLVTRGWDDCAK
QAYLYTNDYLLVYDDPGSLKIKSQYARTSGLAGISFYYSMGFPNGFIQAAMAPWPQVSDI
KVY

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	35	397	1.4e-31	0.918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	6.51e-33	36	397	1	329	Glyco_18 domain.
395573	Glyco_hydro_18	1.92e-31	36	397	1	302	Glycosyl hydrolases family 18.
119351	GH18_chitolectin_chitotriosidase	4.03e-29	101	394	70	333	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	6.97e-23	101	412	126	433	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119365	GH18_chitinase	1.62e-22	37	396	1	316	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP42832.1|GH18	3.11e-58	37	410	37	414
CRX79101.1|GH18	3.58e-36	85	394	22	335
ABB90389.1|GH18	3.02e-33	34	401	37	405
CDR43393.1|GH18	1.31e-32	93	404	80	395
AFD19009.1|GH18|3.2.1.14	7.09e-32	53	401	93	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BT9_A	3.69e-19	101	401	157	447	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
5XWF_A	3.31e-18	52	397	15	350	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	6.61e-16	101	408	122	412	Chain A, Glycosyl Hydrolase [Niallia circulans]
3WL1_A	6.20e-14	109	393	88	350	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
3WKZ_A	6.20e-14	109	393	88	350	Crystal Structure of the Ostrinia furnacalis Group I Chitinase catalytic domain E148Q mutant [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	6.20e-15	101	408	154	444	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|P36362|CHIT_MANSE	3.71e-12	101	393	95	366	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q9WTV1|CH3L1_RAT	4.05e-12	102	393	88	346	Chitinase-3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chi3l1 PE=2 SV=3
sp|O81862|CHIC_ARATH	7.16e-12	93	414	79	366	Class V chitinase OS=Arabidopsis thaliana OX=3702 GN=ChiC PE=1 SV=1
sp|Q62010|OVGP1_MOUSE	2.42e-11	75	393	56	351	Oviduct-specific glycoprotein OS=Mus musculus OX=10090 GN=Ovgp1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999738	CS pos: 20-21. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in PGTG_03208-t26_1-p1.