CAZyme Information: PGTG_02189-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_02189-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460		48943.28	6.0354

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178266:779172-780926(-)

Full Sequence      

MFLSSLFVAFLPVLGAICDEFANDDVRSGATSHASSTSRRYRHRKVGSMSEKCYFFDVGP
WRSIPLYGIRCHHERISRSPARSGGRKTAPQTQANQTDTSGNTTASVASANTTVSPDSST
SAPVTPSDNSTALQNSSTSASSADVSDNSTASQPSNTSTVSTPVASGNAAAPAAVMGLDS
SHLSHNGLSLGFLPDGGDAGGTRQTMADINSAVGQVSSVYGWYGQAVSGTLFDGAQLTAV
IDDVKASGAVFQPAVMPVQGWKGLTSSDNSQAVAIAQVMKKFTDQGIPVWLRFAHEMNYY
QTDGTYVGNAADFKAGWAAVAAACKSIAPDVKMWWTPNVASAENYAEYEPDDMSTVHLVG
IDFYPKSLQTGKEFLDTMKPFHDKYAVDGRMFAIGETGLGYAGTPAERFSWLSQVTAARS
EMKNYVSAAWFNYLKDYDYQIVSLKTPSLTSDLKSFLAAS

Enzyme Prediction     

No EC number prediction in PGTG_02189-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236776	PRK10856	2.72e-05	88	168	170	252	cytoskeleton protein RodZ.
165513	PHA03255	3.47e-05	79	166	45	134	BDLF3; Provisional
411196	act_recrut_TARP	7.33e-05	77	271	357	543	type III secretion system actin-recruiting effector Tarp. The founding member of the Tarp (translocated actin-recruiting phosphoprotein) is CT456 from Chlamydia trachomatis. Tarp is a type III secretion system effector. Orthologs are found other Chlamydia, but are highly variable in length because many lack much of the repeat region.
282904	Herpes_BLLF1	5.11e-04	89	166	491	570	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.
237019	PRK11907	0.002	88	167	34	111	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41322.1|GH26	2.56e-130	178	459	180	458
CDI53094.1|GH26	2.96e-68	180	438	15	285
CDU25855.1|GH26	4.05e-67	180	438	14	284
SJX62385.1|GH26	8.23e-67	180	438	14	284
SAM81579.1|GH26	1.86e-64	180	438	12	282

PDB Hits     

PGTG_02189-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PGTG_02189-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.480831	0.519144	CS pos: 18-19. Pr: 0.4268

TMHMM  Annotations     

There is no transmembrane helices in PGTG_02189-t26_1-p1.