CAZyme Information: PGTG_02162-t26_1-p1

Basic Information

• Species: Puccinia graminis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia graminis
• CAZyme ID: PGTG_02162-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		37163.24	9.7347

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PgraminisCRL75-36-700-3	16309	418459	509	15800

• Gene Location: location=DS178266:669226-670856(-)

Full Sequence      

MLVYKMQQALLMAIFLFASVSLAVGPVPGMGSVVEERNGANTNSGAAGGAPKRIFDFTLT
PNMKTADLDNPQSALSKLIAYIVKSAAKASTYVSILHPSNAASQIQLAIRDDSIFIPGGN
PANAQHGFRRTDVNPAIDKATTLTGITTWYQTIRLDSKAPLVLTHGYLFASIEVPSGDHI
FDIFGGSNFDPQNTDHKPTSNSQTIRVRDFNTKTLLSLPLKYDQDYNFAVTVDWTQNTLT
VYSSIGNQPLQKAGGPFPNDPKAMSPEFKQKGEYHIQLIKFPLADAKVPVAKRLDTPHFG
FQEPIKQEHVTFSNVYATAGKEIEQPKFSGSKSKKIKRSD

Enzyme Prediction     

No EC number prediction in PGTG_02162-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	58	321	1.9e-28	0.9450980392156862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	5.02e-50	54	316	2	244	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL40783.1|GH131	4.04e-36	54	322	27	297
QRV95300.1|GH131	5.65e-36	54	303	22	281
QRV80910.1|GH131	2.24e-34	54	303	22	281
QRW09714.1|GH131	8.51e-34	54	303	22	281
QRW22550.1|GH131	1.63e-32	54	320	22	298

PDB Hits     

PGTG_02162-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PGTG_02162-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999720	CS pos: 23-24. Pr: 0.9809

TMHMM  Annotations     

Start	End
9	31