CAZyme Information: PADG_12370-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_12370-t30_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766		83707.59	7.5085

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275969:182870-185888(-)

Full Sequence      

MLLMAMQCLPGVRAFRCLSGVNCLCDNVDVDIPSFSLVTQFPPTGVRLQATRTPGVYHTE
LEKDVRDSIQPFPTGISYVVFEDHIGLPHPEYPHLDIVPSKVLYSNSACYYKGNWCPGLP
HAEENRISSWLLDQSTGAPPKFATVTSSKVRSGSPYHIPLYLAAPSATSRSPPRETATVH
PSGTAGHSQTLEISTNIPHPTPSSMSHQDIFEPIDKGPIPSNINSRSDHPVRKDHISDTP
GPISTNKFYANFFLGTQTGYAFVHPYAVGWAKGTGNARSYGVLISHIESHQLAFGPKSQV
IPGNPVQFYINPIGIQSMILSASELGTSTVLTVSKAKAFSANIILRPHRGSNSTIIFPLV
QGMGYVTGIYTGLQPAIQSSVFFRKLESVASPKPGIYKYKVTLEDNTHWLIYVTPSGNGG
NPNLVLVSNTLISGPTGYSGIIQVAKNPSGLAGEAIYDRTTGVYPTEAHVSGSVVAHQAM
GTYKLSWQKAGKNVNSTPLLMFALPHHVQSFDTHTNHMKTDMLLRTTTKGNATACVGNSW
TMVEENLPVNIGFGPFDPNTGREATLSNATRQRIREVAPSELSQDISRQTNLNSMYFSGK
ALNKFAMLVYTVYELAKDASLSESAFSSLKSAFASFNNYVWMKSDNVNQPDADTPQLFEN
KADHTTYFGTNLEYIQGIHMLPLIPSSTYIREKEFVSEEWYAMFAENASTPASGVQGGWQ
GILYANLAIIDPNASWTFFNKEPFDLSKIDGGATRTWYLAFAAGRF

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	229	636	2.8e-91	0.5514469453376206

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397619	Glyco_hydro_81	1.27e-151	229	558	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
227785	Acf2	2.12e-108	163	764	7	754	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	1.07e-68	565	759	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67487.1|GH81	1.30e-222	205	764	128	845
QSS57493.1|GH81	2.67e-219	205	764	128	845
QSS66079.1|GH81	3.22e-218	197	764	122	847
ABH10633.1|GH81	1.37e-215	205	763	1	712
CAP93568.1|GH81	9.40e-208	202	764	174	890

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.73e-35	203	765	1	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.89e-35	193	765	15	743	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	8.70e-32	203	765	1	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	2.38e-229	68	766	71	903	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	4.37e-85	209	764	2	701	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.76e-67	210	764	47	736	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	1.68e-63	209	764	427	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.04e-60	220	764	411	1111	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993879	0.006147

TMHMM  Annotations     

There is no transmembrane helices in PADG_12370-t30_1-p1.