CAZyme Information: PADG_07615-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_07615-t30_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	KN275968|CGC4	45982.93	7.2760

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275968:126132-127460(-)

Full Sequence      

MNFSSLNLALASCVLAWVCLASASSHVASHIVPRQAGSAIYGVNIGGWLLLEPWISPSVF
EAGGSSSVDEYTLSKNLGRDAKRHLSKHWDTFITEDDFKNIAAAGLNHVRIPIGYWAVNP
IEGEPYVQGQLDYLDKALVWAKNSNLRVVIDLHGVPGSQNGFDNSGHRGAVNWQKGDTIR
QTLIAIHTLAIRYANRTDVVDSIELVNKPSIPGGVQVSLLKEYYEDGYHIVRDIDSTVGV
SISDASLPPRTWNGFLAPKTYKNVYLDTYHNQVFDDIFRTFTIDQHVKLACSLPHDRLRG
ADKPLIVKEWSGAMTDCAMYLNGRGIGSRFDGSFPSGKPSGACGARSKGSSSELSAQQKK
DTLRYIEAQLDAFEVGAGWYFWTWKTEGAPGWDMQDLLNQKLFPQPIWARKYGGCR

Enzyme Prediction     

No EC number prediction in PADG_07615-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	87	387	1.8e-109	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.34e-56	40	414	18	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	4.26e-07	90	312	22	238	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAG36698.1|GH5_9	1.69e-315	1	416	1	416
AAC49253.2|GH5_9	1.69e-315	1	416	1	416
QSS61799.1|GH5_9	3.52e-190	2	416	3	416
QSS56663.1|GH5_9	1.35e-187	5	416	6	416
QSS71511.1|GH5_9	1.10e-186	5	416	6	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	2.25e-106	38	412	7	387	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	3.18e-106	38	412	7	387	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	3.84e-106	38	412	13	393	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3N9K_A	7.45e-106	38	412	12	392	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
2PC8_A	1.09e-105	38	412	13	393	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B5X8|EXGA_EMENI	2.92e-150	40	412	29	399	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|B0XN12|EXGA_ASPFC	1.72e-149	25	412	27	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	2.44e-149	25	412	27	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	5.63e-148	25	412	27	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
sp|A2RAR6|EXGA_ASPNC	1.60e-147	32	412	26	411	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000370	0.999592	CS pos: 23-24. Pr: 0.9729

TMHMM  Annotations     

There is no transmembrane helices in PADG_07615-t30_1-p1.