CAZyme Information: PADG_07170-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_07170-t30_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666	KN275966|CGC2	75286.08	5.5009

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275966:823444-825901(-)

Full Sequence      

MPQNHLHKQQHPPKIKTSSREGQKDPFQDPSPPCYLITPPQPPYSPAYQQGSSVQTNDSL
DHLAPPHYSRRYQTDKDVSMGYSNFSSRRTSWSSEGGSWESRGHLLNSSGKYWDHSRVSS
VAEDEINTQTVVEKYAIMPDYDNLLVYPEDVEKDDYLHNPDPSDSDRDCEVCSRRGILNI
AGLIIVLLGAMTLFIIYPLLTFFDKLKEGDKPTCTDDSCLDVGPIPHLQNLRTSLIDPDT
PQSVRSITSSSGKQWKLVFSDEFNKDGRTFYDGDDPFFQAVDIWYGVTQDLEWYDPDAIT
TRNGKLEIRFDAFKNHGLDYRSGMLQSWNKLCFTGGRLEASISLPGRGDTSGFWPGFWTM
GNLGRPGYAATTEGMWPYSYDDICDAGITPNQSSTDGISWLPGMRLPACTCKGEDHPNPG
KSRSAPEIDVIEASVHALDPKLPSTIGDVSQSVQVAPFDVWYMPNFEFYELYNPSISSIN
NYRGGPYQQAVSGLTNINNKWYDGKEYQVYAFEYKPGKNGEISWFVGADKTWKLDARALG
PNGNVGQRVIPVEPMALILNFGMSKTFAPLNLTGLAKLMPATMRFDYIRIYQDPDKESVT
CDPTGYETTRYIRTHLDAYNNPNKTRWWSTRVIRGPKIHTCIDAMFDSSRPNPTLHLYRR
NNERTC

Enzyme Prediction     

No EC number prediction in PADG_07170-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	261	591	2.4e-152	0.9969325153374233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	0.0	144	627	1	484	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	5.13e-170	257	592	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	9.83e-70	223	605	17	355	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	1.25e-18	259	591	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	1.57e-05	255	377	2	126	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS72113.1|GH16_2	0.0	17	627	21	628
QSS57285.1|GH16_2	0.0	71	627	74	629
BAE59904.1|GH16_2	1.56e-274	13	627	14	641
QRD86509.1|GH16_2	1.56e-274	13	627	14	641
QMW42142.1|GH16_2	1.56e-274	13	627	14	641

PDB Hits     

PADG_07170-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P87024|SKN1_CANAX	2.57e-173	149	627	243	722	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P32486|KRE6_YEAST	1.71e-172	149	627	214	695	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|O13941|YEPB_SCHPO	3.59e-165	152	627	132	611	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P33336|SKN1_YEAST	4.00e-163	52	627	142	747	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87023|KRE6_CANAX	1.25e-159	149	625	240	723	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

Start	End
177	199