CAZyme Information: PADG_07133-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_07133-t30_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		86525.39	9.7453

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275966:697789-700276(+)

Full Sequence      

MPYTAPAPLLTAQLHPHLASAGPLATTRRHGRQNSEPAMNSSGSPPPLQRAHSSSSYIYR
HRRSLVVSQNTSSSGELGIESKDGRRNSPSPTNTPHAALWKSPSGAMIPTGVVISPPDSK
SNSSDDEETTTPGSQRLILADFEAAIMSIDQISLQTPTKKRGPVKPSPKIQRTPSPLDLS
LALAAEVKGPRVKAHLEEDDLSIPGLNTPNGVIHAHSSEIATHTPEDSDRGEDEMELALK
PSMVRKKSGELVRPALRPKRRPSSAPGTPMFSKAVHFDSQLEHIRHFLQVDKPLAVSAGS
SPIETYDGDNEFPFGNSDDRPSQPNLFEWDARIANFPVDQEARKHMPVRLERIFLSPGNK
CLVGVVAVANISFQKHVVARFTSDYWKTTSEVIAEYNNDVRRKEANDGYDRFNFSIHLAD
MGNLETKRMFICIRYNVNGLEFWDNNNTMNYHVDFCKNPKQRNKGTQAGNSPGPRPTSTL
PRSRPSDPLASRSRSVPPFPGDFGKSPPSPALPDRRLELEKPPAKPPPCKDDCFLETPIR
RSSTASQTFGNRYDFGASLSAAMQPGSVDQTRRGKRSDQAVKYMPESTSTTSITNNAPAV
SKPEGGKPARPDEKFEPTAATSPGASSKLSTSSPGPMKPTDIVSGQPYHQSPMYKELVDK
YCFYGSSKTGSLSTTHFSRRHHHQSATRNATTPGNNDCVSSYSTITPSSKDKPLSADYKP
STATATATTTTNPDNNNRSTTKHTSLIRSQGGAGLTTTSPSSSPPSNYSTHPPYHHQSMQ
KTFFSESLTLTFI

Enzyme Prediction     

No EC number prediction in PADG_07133-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	346	453	1.6e-32	0.9719626168224299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	7.66e-52	343	454	2	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	1.45e-08	370	453	5	75	Starch/carbohydrate-binding module (family 53).
282904	Herpes_BLLF1	0.007	474	713	565	809	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS57244.1|CBM21	3.50e-240	1	682	1	656
QSS61205.1|CBM21	1.10e-230	1	682	1	656
QKX59775.1|CBM21	1.09e-122	1	676	1	579
BCS08756.1|CBM21	1.13e-121	1	666	1	620
BCR96239.1|CBM21	1.13e-121	1	666	1	620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2M83_A	2.59e-12	326	451	13	131	Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]
2EEF_A	1.15e-08	359	453	45	135	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5U2R5|PPR3C_RAT	5.61e-11	309	453	111	256	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|Q7TMB3|PPR3C_MOUSE	1.00e-10	309	453	111	256	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q00756|PPR3A_RABIT	9.25e-10	326	451	111	229	Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1
sp|Q9UQK1|PPR3C_HUMAN	3.26e-09	360	453	167	256	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
sp|Q99MR9|PPR3A_MOUSE	1.07e-08	357	461	139	238	Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PADG_07133-t30_1-p1.