CAZyme Information: PADG_06012-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_06012-t30_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	KN275963|CGC2	33686.54	6.8447

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275963:1052086-1052997(-)

Full Sequence      

MISLFSYKNRTALTSRNVTSFKSFLSSSSTSSKPIPQKIWYKLGAKGISSKIQEWTATCI
SKNPTYVTEFLTDDSADEYVKVHFSHRPDIVDTYLSLPIPILKADMLRYLLLIAEGGIWN
DLDVSCGDIPIRDWIPEQFKKDANLVVGWEFDVGWGESIIRQFTSWTIMARPGSKHLEMV
VLDILDAIDKTKKKHKLAKTTELQMPMLGDIVDFTGPRRLTSGIFKSLSEELGGEVNAGN
ASNLLSPKLLGDVLILPGFAFASSTNRYEGVKGPDGKDFEPGPSLVTHHYAGSWRNEHGG
EVV

Enzyme Prediction     

No EC number prediction in PADG_06012-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	52	137	1e-17	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.33e-19	34	173	81	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.06e-09	58	138	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAK54761.1|GT32	6.86e-191	2	294	61	353
QQK44540.1|GT32	3.83e-105	35	301	59	317
CAE7002672.1|GT32	1.06e-101	28	303	65	334
CAE7026497.1|GT32	2.06e-98	35	301	52	311
CAP99443.1|GT32	1.01e-97	71	302	1	224

PDB Hits     

PADG_06012-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	8.19e-30	35	297	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.77e-27	32	297	96	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	4.88e-25	36	296	131	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.73e-15	31	184	92	282	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	2.53e-06	59	126	86	150	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PADG_06012-t30_1-p1.