CAZyme Information: PADG_06004-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_06004-t30_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626		68003.44	7.4965

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275963:1026713-1028898(-)

Full Sequence      

MLHSFILSRASRSLCCALLLFASLVTSSAVTNGRGKWEKRIENEYDYIIVGGGLTGLVAA
HRLSENSRVSVLVLEYGVIDRSDATKIPYMGTFLNFPNMFNITTAPEPGLEGRIYSIRAG
SVVGGGTTVNGMTYDRASAADYDSWEQLGNRGWGWQGLLPYFKKSAQFTPPPQEVVDEYE
YTYDQSAYGSRSPLKITYPHWQAPDLYKMSDAFTEMGIPFRNEHASGDAIGKFWAPASID
AKTMTRSSSLTAYYDTASSRDNLKLLTEHQVISLTFNENSNIVSGVKAIDRKTNKEETFR
AKKEVILAAGAIHTPQLLQLSGIGPKAVVEAAGITSKIDLPGVGSNFQDHPVAYLNWRVA
NNFPEPNAIAINATFAGEALELYNNLKTGPYTKAQASMIAFLTLSMITDDVDALIKSLNE
QNSATYLPTVYSNSALLVGFEAQRNILAKQLKEGSVAAMELPISGSGSVPNSIQKPLSRG
TVHLNPDNPRGEPIVTYHALKNPFDRALIATFINFTRRYFKTTALASLKPEEVSPGVEAQ
TEDEIIAKLIAGGPLSFGPSFAHPSCSCPMMPRAKGGCVSADLLVYGTKRLSIIDASIMP
IIPAAHLQASVYAIAEKAADIIKRRG

Enzyme Prediction     

No EC number prediction in PADG_06004-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	44	624	2.9e-169	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.89e-84	42	625	3	534	choline dehydrogenase; Validated
225186	BetA	4.26e-80	40	625	3	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	4.74e-37	112	352	16	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	4.49e-33	476	618	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.06e-18	27	352	38	329	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS75262.1|AA3_2	2.61e-259	132	625	1	493
QDS77604.1|AA3_2	1.70e-215	38	625	22	613
QSS59059.1|AA3_2	2.07e-201	209	611	1	402
ATZ53654.1|AA3_2	3.80e-169	19	625	15	620
QRC90410.1|AA3_2	4.02e-169	11	625	5	614

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	3.01e-116	22	622	12	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.33e-109	41	624	2	584	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	1.45e-69	45	623	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	2.56e-62	44	623	1	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
4H7U_A	1.02e-61	44	624	40	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	6.70e-110	18	623	7	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	3.39e-76	19	622	22	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.39e-76	19	622	22	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	1.50e-69	46	624	41	631	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.58e-67	41	624	10	610	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.144635	0.855330	CS pos: 29-30. Pr: 0.8133

TMHMM  Annotations     

There is no transmembrane helices in PADG_06004-t30_1-p1.