CAZyme Information: PADG_05592-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_05592-t30_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	KN275962|CGC2	43747.66	10.0670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275962:1665428-1666861(-)

Full Sequence      

MNIYERAIDVTTNPNHSKWISSLLLIADIFLCALVVWKVPYTEIDWTTYMQQVSLFLSGE
RDYALIKGSTGPLVYPAGHVYVYSALYYICDGGRDIFFAQVLFSILYLATLVIVMWSYRF
VKAPPYLFPLLVLSKRLHSVFLLRLFNDGIATFFLWAGIFALQRRRWSAGVILWSMGVGV
KMTLLLVAPAVTVIAVLGVGILRAAGLGATALWLQVLFALPFLKENPRSYISRSFEFTRQ
FLFRWTVNWRFVGEKVFTSNTFAVALLALMKNIVRGRQLPIQIVNSFIMTTMLSSLAIGL
LCARSLHYQFFAYLSWATPYLLWKSGFHPVITYLLWAAQEWAWNVYPSTTVSSITVVSGL
SIQVFGVFWNGYQMRFSNKEHKD

Enzyme Prediction     

EC	2.4.1.258:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	23	270	9.5e-107	0.6785714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	22	353	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS72893.1|GT58	3.80e-207	1	382	1	406
QSS55330.1|GT58	2.54e-205	1	382	1	406
QSS65569.1|GT58	7.85e-173	50	371	1	346
BCR98022.1|GT58	6.99e-164	9	381	9	411
BCS10476.1|GT58	6.99e-164	9	381	9	411

PDB Hits     

PADG_05592-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U6A4|ALG3_ASPOR	5.81e-163	9	370	9	394	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	3.14e-159	1	381	9	417	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	1.67e-154	9	381	71	470	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	7.48e-151	1	381	1	409	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1
sp|A2RA94|ALG3_ASPNC	1.76e-141	9	381	9	407	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000002

TMHMM  Annotations     

Start	End
19	41
72	89
96	118
140	162
169	191
201	223
247	269
279	301
313	335
350	372