CAZyme Information: PADG_05123-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_05123-t30_1-p1
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1454	KN275962|CGC1	161741.68	6.5148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275962:87390-91957(+)

Full Sequence      

MPPYDEFRSKVGAGRPNTDSTSSNRLSLSHIPERLRIGDDEQEDMAAPPSDTAGRAGMLT
HMHQSVFSMIAAASSKNDFHTRFDEYSDADEDTDQPLKNRFLSNDGIDSRGVDSPSKDQL
TQIAHGDKPSPSSKTLNERGRSFHRLRMSEGQFLKSLSKLPGKSSTGKETTPEPDVTASN
EPSAGEAVQLVASTEAPVQGLMREAQARFGESESPPNQTGISEKDRQRKESSPSSLLSAR
LMDIFGFDRPEKVISEYQCWLLQSVLLQGYMYITERHISFYAYLPKKSHTIVKSGYLSKR
GRQNPKYSRYWFTLKGDVLSYYLDPSNLYFPSGQIDLRNGISASLMEHKGKDKDVRDFTI
TTDTRIYRFRADSATNAREWVKTLQKVIFRSHNEGDSVKISLPIENVIDIEENPVIDLAD
TFKIRVFESGESCAVDEYFFSFFECGKEAIEVLKKLVNQTAEQQIQHNALAPDYGRASRP
RSQSAGAYSPPCGTTLHPESVRATLRPWSPLRDRSRSPKISGLRGLMQGHIYEPNVAGLG
QRRRSESIGRVNVGDHPPERSPESKFQSSSDSFVQSLEHATEVSAILQSACGTAESASQI
LNRSDVFQSPTIHRLRPSSSESGDEPRRHSEDTTRFVPSGAEVEVLNQPPTRTQITESLM
RSGPVEPLDGGGDSEHDLQHRSAARSASSPTLQELMKAGSYPLQRAAGFLKSRSKRMSNI
LATESMGYFEKVSGMWIGGKKHYGEGQAVLSDDRMVDPEDEEQGCGHGQRFRAHFALPPS
EKLVATYFAYLHRVLPLYGKLYISNRKMCFRSLLPGTRTKMILPLKDIENVEKEKGFRFG
YHGLVVIISGHEELFFEFNTADGRDDCAVTLHQNLESIRYLVESGLFAQQEKEEAEAAMA
EHQMLQEARLGGLDEQQGSQTLSSSVPLSPATSPILFDDPRVSMVNFKPHESLRITCLTI
GSRGDVQPYIALCKGLIAEGHRPKIATHKEFEPWIRHHGIEFAPVEGDPAELMRICVENG
MFTYSFLKEASSKFRGWIDDLLSSAWKSCQNSDILIESPSAMAGIHIAEALGIPYFRTFT
MPWTRTRAYPHAFAVPEHKMGGAYNYITYVMFDNVFWKAIAGQVNRWRKRELGLRGTNLD
KMQPNKVPFLYNFSPSVVPPPLDYSDWIRVTGYWFLDEGASWTPPAELTSFIEQARADKK
KIVYIGFGSIVVSDPAALTKTIVDSVLRADVRCILSKGWSDRLGDPSSGKVEITLPPEIH
QIKAAPHDWLFSQIDAAAHHGGAGTTGASLRAGIPTIIKPFFGDQFFFGSRVEDLGVGIC
MKRLNVSAFSRALWEATHSERIIVKAKALGEQIRKEDGVATAIQAIYRDLEYAKTLVRQR
SHTLSASQTGALATSTLDEPGIDIPDMGLDDDGHGSGSGSGDPDFYGAMEDSWTFVGDET
DSDRAKRSGDREEL

Enzyme Prediction     

EC	2.4.1.173:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	955	1368	1.6e-56	0.9790575916230366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.43e-77	953	1366	1	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
275403	PH-GRAM2_AGT26	1.68e-54	780	872	1	93	Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 2. ATG26 (also called UGT51/UDP-glycosyltransferase 51), a member of the glycosyltransferase 28 family, resulting in the biosynthesis of sterol glucoside. ATG26 in decane metabolism and autophagy. There are 32 known autophagy-related (ATG) proteins, 17 are components of the core autophagic machinery essential for all autophagy-related pathways and 15 are the additional components required only for certain pathways or species. The core autophagic machinery includes 1) the ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and ATG27), 2) the phosphatidylinositol 3-kinase complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known about how the core machinery is adapted or modulated with additional components to accommodate the nonselective sequestration of bulk cytosol (autophagosome formation) or selective sequestration of specific cargos (Cvt vesicle, pexophagosome, or bacteria-containing autophagosome formation). The pexophagosome-specific additions include the ATG30-ATG11-ATG17 receptor-adaptors complex, the coiled-coil protein ATG25, and the sterol glucosyltransferase ATG26. ATG26 is necessary for the degradation of medium peroxisomes. It contains 2 GRAM domains and a single PH domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
275402	PH-GRAM1_AGT26	2.57e-54	271	388	1	116	Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1. ATG26 (also called UGT51/UDP-glycosyltransferase 51), a member of the glycosyltransferase 28 family, resulting in the biosynthesis of sterol glucoside. ATG26 in decane metabolism and autophagy. There are 32 known autophagy-related (ATG) proteins, 17 are components of the core autophagic machinery essential for all autophagy-related pathways and 15 are the additional components required only for certain pathways or species. The core autophagic machinery includes 1) the ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and ATG27), 2) the phosphatidylinositol 3-kinase complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known about how the core machinery is adapted or modulated with additional components to accommodate the nonselective sequestration of bulk cytosol (autophagosome formation) or selective sequestration of specific cargos (Cvt vesicle, pexophagosome, or bacteria-containing autophagosome formation). The pexophagosome-specific additions include the ATG30-ATG11-ATG17 receptor-adaptors complex, the coiled-coil protein ATG25, and the sterol glucosyltransferase ATG26. ATG26 is necessary for the degradation of medium peroxisomes. It contains 2 GRAM domains and a single PH domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
224732	YjiC	1.02e-47	954	1366	3	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.62e-32	955	1090	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51257.1|GT1	0.0	1	1452	1	1465
QSS69260.1|GT1	0.0	1	1452	1	1464
QMW35213.1|GT1	0.0	20	1451	22	1365
QMW47275.1|GT1	0.0	20	1451	22	1365
QRD91604.1|GT1	0.0	20	1451	25	1368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	9.43e-183	935	1394	2	463	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.90e-182	935	1394	22	483	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	6.37e-18	961	1386	9	391	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	7.01e-15	953	1319	1	348	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]
6KQW_A	1.12e-08	955	1366	6	381	Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WID6|ATG26_ASPFU	0.0	20	1451	22	1379	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
sp|Q0CKU4|ATG26_ASPTN	0.0	2	1447	3	1371	Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg26 PE=3 SV=1
sp|Q0UY53|ATG26_PHANO	0.0	26	1379	29	1379	Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=ATG26 PE=3 SV=1
sp|Q2U0C3|ATG26_ASPOR	0.0	20	1451	25	1368	Sterol 3-beta-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atg26 PE=3 SV=2
sp|Q7S1I0|ATG26_NEUCR	0.0	31	1454	90	1510	Sterol 3-beta-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=apg-12 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PADG_05123-t30_1-p1.