CAZyme Information: PADG_04918-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_04918-t30_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529		57044.15	5.2458

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275961:1451406-1453342(-)

Full Sequence      

MKFSSVLAGAALAGTGLAADLDPIVIKGSKFFYKTNGTEFFMRGVAYQQEISSNGTTSEN
GYKDPLANAEACKRDVPLLQELRTNTIRVYAINPKEDHKVCMELLQNAGIYVVADLSEPD
LSINRDDPKWDDDLYARYTAVIDTLAPYSNVLGFFAGNEVSNNKSNTQASAFVKAAVRDS
KAYIKKKGYREIGVGYATNDDADIRQDMSNYFNCNNRAESIDFWGYNIYSWCGDSSFKES
GYDVVVKEFSSYSVPVFFAEYGCNVVRPRKFTEVAALYGPQMTPVVSGGIVYMYFQEDNN
YGLVDINGNTAKGRPDFKNLKDQMSKVNPKGVNMNDYKVENTELRTCPAVGSSWKANRSL
PPTPNKYLCGCMVKSLSCVAKDSLDTEELGDNFNTVCGLGKGVCDGISIEPENGVYGAYS
MCNPREKLSFAFDSYYQQQAKAGNGDSACDFKGAAQRQKPTQATGTCADLMKQAGANGKG
TVTSGPGGPAGTSKGAASVGAVPAVDFGMVRVGAGVVAGVIAGMSILLL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	19	327	7.1e-137	0.9903846153846154
CBM43	377	467	1.4e-20	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	8.37e-164	20	327	8	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	2.11e-28	376	455	1	75	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	3.61e-21	376	467	1	83	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF93407.1|CBM43|GH72|2.4.1.-	0.0	1	529	1	529
AAP91684.2|CBM43|GH72|2.4.1.-	0.0	1	529	1	529
EEH34019.1|CBM43|GH72	0.0	1	529	1	529
QSS51152.1|CBM43|GH72	4.86e-275	1	529	1	527
QSS69151.1|CBM43|GH72	9.79e-275	1	529	1	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	7.00e-126	15	449	26	466	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	1.97e-125	15	449	26	466	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	1.97e-125	15	449	26	466	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATC3|GAS1_ARTBC	1.01e-250	1	529	1	545	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|B0XVI5|GEL4_ASPFC	9.04e-189	1	475	1	487	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	9.04e-189	1	475	1	487	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|P0C955|GEL3_ASPFU	1.64e-175	1	491	1	485	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	3.65e-175	1	488	1	482	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000281	0.999717	CS pos: 18-19. Pr: 0.9699

TMHMM  Annotations     

There is no transmembrane helices in PADG_04918-t30_1-p1.