CAZyme Information: PADG_04536-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_04536-t30_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		55803.86	6.6197

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275961:231413-233154(-)

Full Sequence      

MKNNNRVLFLTNCESGLANVHLATAHSILTSYPDTEVHFVSFPRLAPFVENVNKYATRQS
PSTGLDNVNRIILHELSGPSYGKALVSGWTKTHDDVIHGPGLSGLSHLTRFVERAAVPWN
GSEYVGLYREVCQLINEIDPAVTVIDTLFAPGADAVTSLTRKYILMSANALSDNFAGSQP
RAAMLWKFPAFSSGYPFPVPWYLIPANILYNLRLLKTIAFGPLQRELTAHTKSQGLGKPR
DVFNIYDKNVPWLSPSLVESDYPLVIPSNVTPCGPIFLSLGSIPERDPELAAWLERAPTV
LVNLGSMTTYSQADAEEMVGAIRILLDNTGVQVLWKFFKRHDYSDDFLIPLADDLASGRV
RIEGWISVEPASLLESGHIVLSVHHGGSNSFHEAIGTGIPQIALPLWVDCYGYAVRAEWL
EVGIWGSRKTAPSWTAKELGQAFLTAVGDGAEAKFMAEKARKLGELAKKAPGRVVAARKI
VEYMKMKLGESEESEVPSHNGTGPVVKEL

Enzyme Prediction     

No EC number prediction in PADG_04536-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	174	483	1.4e-23	0.6910994764397905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	7.10e-24	171	483	106	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.32e-12	133	480	80	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	3.25e-05	248	472	198	439	UDP-glucosyl transferase
177857	PLN02207	3.36e-05	194	409	179	381	UDP-glycosyltransferase
178170	PLN02555	6.00e-05	270	470	239	449	limonoid glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ37360.1|GT1	2.11e-166	4	486	45	523
APA10835.1|GT1	9.75e-163	4	486	43	525
ATZ52353.1|GT1	9.95e-159	4	485	43	518
CCD43782.2|GT1	2.03e-155	4	485	43	517
CEI41903.1|GT1	2.40e-138	4	482	34	508

PDB Hits     

PADG_04536-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	6.74e-76	7	442	8	433	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	6.41e-75	7	477	8	499	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	6.44e-08	360	496	442	573	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|Q1LZI1|UD3A1_BOVIN	1.25e-06	265	424	261	408	UDP-glucuronosyltransferase 3A1 OS=Bos taurus OX=9913 GN=UGT3A1 PE=2 SV=1
sp|M9MH90|EMT1_PSEA3	3.15e-06	360	478	443	557	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PADG_04536-t30_1-p1.